KEGG   Staphylococcus pseudintermedius ED99: SPSE_1648Help
Entry
SPSE_1648         CDS       T02008                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00020  Citrate cycle (TCA cycle)
sdt00190  Oxidative phosphorylation
sdt00650  Butanoate metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
Module
sdt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSE_1648 (sdhB)
   00650 Butanoate metabolism
    SPSE_1648 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPSE_1648 (sdhB)
Enzymes [BR:sdt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPSE_1648 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SPSE_1648 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4 Fer4_15 Fer4_13 Fer4_21 Fer4_18 Fer4_6 Fer4_4 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADX76903
LinkDB All DBs
Position
complement(1684745..1685560)
Genome map
AA seq 271 aa AA seqDB search
MAETQEKQQTSQQVQNSTSNKTIKLIIKRQKDQNSSPYEESFEIPYRENMNVIAALMEIR
RNPINTKGEKTTPVTWDMNCLEEVCGACSMVINGKARQSCSAIIDQLEQPIRLEPMTTFP
VIRDLQVDRTRMFDNLKRMKAWVPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTKTNSFVGAQAISQVRLFNLHPTGAMTKDERLDALMDQGGLQACGNSQNCVQACPK
GIPLTTSIAAMNRETSFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacacaagagaaacaacaaacatcacaacaagttcaaaatagcacttcaaat
aaaacaattaagttaattattaaacgacaaaaggatcaaaattcatcaccatatgaagaa
tcttttgaaattccttatcgtgaaaatatgaatgtcatcgcagcattaatggaaattcgt
cgtaacccaatcaatacaaaaggtgaaaaaacaacaccggtaacatgggatatgaactgt
ttagaagaggtctgtggtgcatgttcaatggtcattaatggtaaagcccgtcaatcatgt
tcagcgattatcgatcaattagaacaaccgattcgtcttgaaccgatgacgacattccca
gtcattcgcgacttacaagtagatcgtacgcgtatgtttgacaacttgaaacgtatgaaa
gcatgggtgccgattgatggtacgtatgacttaggtcctggtccacgtatgccagaaaaa
aaacgtcaaacagcttacgaattatcaaaatgtatgacatgtggggtatgtttagaagta
tgtccaaacgtcacaaaaaccaatagtttcgtcggtgctcaagccatttctcaagtgcgt
ttgtttaacttacatccgactggtgcaatgacaaaagacgaacgtttagatgcgttaatg
gatcaaggtggtttacaagcttgtggtaactcacaaaattgtgtgcaagcttgtccgaaa
ggtattccgttgacaacttctattgcagcgatgaaccgtgaaacatcattccatatgttc
aaatcattctttggttctgatcatgaagtagaataa

DBGET integrated database retrieval system