KEGG   Staphylococcus pseudintermedius ED99: SPSE_1649Help
Entry
SPSE_1649         CDS       T02008                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00020  Citrate cycle (TCA cycle)
sdt00190  Oxidative phosphorylation
sdt00650  Butanoate metabolism
sdt01100  Metabolic pathways
sdt01110  Biosynthesis of secondary metabolites
sdt01120  Microbial metabolism in diverse environments
sdt01130  Biosynthesis of antibiotics
sdt01200  Carbon metabolism
Module
sdt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSE_1649 (sdhA)
   00650 Butanoate metabolism
    SPSE_1649 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPSE_1649 (sdhA)
Enzymes [BR:sdt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPSE_1649 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SPSE_1649 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADX76904
LinkDB All DBs
Position
complement(1685560..1687326)
Genome map
AA seq 588 aa AA seqDB search
MAEKKIIVVGGGLAGLMSTIKAAEQGAHVDLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWVHFDDTVYGGDFLADQPPVKAMTEAAPQIIHLLDRMGVMFNRTAEGLIDFRRFGGTL
HHRTAFAGATTGQQLLYALDEQVRSYEVDGLVTKYEGWEFLGIVKDDENAARGIVAQNIT
TSEIQSFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGVKYGNGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIDGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAVKYVENIEKSYVDM
DDSMYQKRVDEEQARFDKLLNMKGSENAYKLHRELGEIMTANVTVVRHNDKLLETDKKIV
ELMKRYQDIDMEDTSQWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDDEWLKHTLAEYKGPDAPPAFTYKPVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaaaattattgttgtcggaggcggtcttgccggtttaatgtcaacaatt
aaagcagcggagcaaggggcacatgttgatttgttctcaattgttccagtaaaacgctct
cactcagtatgtgcacagggcggtattaacggagcggtaaatacaaaaggtgaaggtgac
tctccgtgggttcattttgatgacactgtttacggtggggacttcttagcggatcaaccg
cctgttaaagcaatgactgaagcagcaccacaaatcatccatttattagaccgcatgggt
gtcatgtttaaccgtacagctgaaggacttatcgatttccgtcgtttcggtggaacatta
catcacagaactgcattcgctggtgcgacaacaggtcaacaattattatatgcattagat
gaacaagtgcgtagttatgaagtggatggacttgtgacgaaatatgaaggatgggaattt
ttaggtatcgttaaagatgatgaaaatgcggcgcgtggtattgttgcgcaaaacatcaca
acttctgaaattcaatctttcggttctgatgcagtgattatggcaactggtggtccaggt
attatttttggtaaaacgacaaactctatgatcaatacaggatcagctgcgtctatcgta
tatcaacaaggggtaaaatatggtaacggtgagtttatccaaattcacccaacagcaatt
cctggtgacgataaattacgtttaatgagtgaatcagcacgtggtgaaggtggccgtatt
tggacgtataaagacggtaagccttggtatttcttagaagagaagtatcctgattatggt
aacctcgttcctcgtgatattgcgacacgagaaattttcgatgtttgtgtgaatcaaaag
ctcggtattaacggtgaaaacatggtataccttgacttatcacacaaagatccacatgaa
ttagatgtaaaattagggggtatcatcgaaatttacgaaaaattcacaggtgacgatcca
cgtaaagtaccaatgaaaatcttcccagcagtacactactcaatgggtggtctttatgta
gattatgatcaaatgacgaacattgatggtttatttgcggcaggggaatgtgatttctca
caacatgggggtaaccgtttaggtgccaactcattattatcagctatttatggtggtact
gttgcaggacctaatgctgtgaaatatgtagaaaacattgaaaaatcttacgttgacatg
gatgatagcatgtatcaaaaacgtgtggatgaagaacaagcacgttttgacaagttgtta
aacatgaaaggttctgaaaatgcatataaattgcatcgtgaacttggtgaaattatgact
gcgaatgtgacggttgttcgtcataatgacaaattgttagaaactgacaagaaaattgtt
gaattgatgaaacgttaccaagatattgatatggaagatacatcgcaatggagtaaccaa
gctgtattcttcacacgtcaattgtggaacatgcttgtgttggctcgcgtaatcacaatc
ggtgcttataatcgtaatgaatctcgtggtgcgcactataagccggaattcccagaaaga
aatgacgatgagtggttaaaacacacattagctgaatataaagggccagatgcaccacca
gcatttacgtacaaacctgttgatgtcagcttaatcccacctcgtaaacgtgattacaca
agtaagtcaaaagggggtaaaaaataa

DBGET integrated database retrieval system