KEGG   Staphylococcus pseudintermedius ED99: SPSE_2002Help
Entry
SPSE_2002         CDS       T02008                                 

Gene name
nrdE
Definition
(GenBank) ribonucleoside-diphosphate reductase, alpha subunit
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
sdt  Staphylococcus pseudintermedius ED99
Pathway
sdt00230  Purine metabolism
sdt00240  Pyrimidine metabolism
sdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPSE_2002 (nrdE)
   00240 Pyrimidine metabolism
    SPSE_2002 (nrdE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sdt03400]
    SPSE_2002 (nrdE)
Enzymes [BR:sdt01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     SPSE_2002 (nrdE)
DNA repair and recombination proteins [BR:sdt03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SPSE_2002 (nrdE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC RNR_N Ribonuc_red_lgN
Motif
Other DBs
NCBI-ProteinID: ADX77247
LinkDB All DBs
Position
complement(2060816..2062921)
Genome map
AA seq 701 aa AA seqDB search
MKTMEQKQYKHIELNNQVTKRNENGFFQLEKDQEALASYLEEIQDKTVHFDSELERLHFL
VDNHFYYNVFEEYSEAQLVELIAFATEIPFRFASYMSASKFFKDYALKTNDKSQYLEDYH
QHVMIVSFYLAKGNVELAKKLIQAMVEQRYQPATPTFLNAGRARRGELVSCFLLEVDDSL
NSINFIDSTAKQLSKIGGGVAINLSKLRARGEAIKGIKGVAKGVLPIAKALEGGFSYADQ
LGQRPGAGAVYLNIFHYDVEEFLDTKKINADEDLRLSTISTGLIVPSKFFELAKEGKDFF
MFAPHTVEQEYGVTLDDINIDEYYDRLVENPNIMKKSKDAREMLNMIAQTQLQSGYPYLM
FKDNANRVHANSNIGQIKMSNLCTEIFQLQETSVIHDYGVDDEIKRDISCNLGSLNIVNV
MESNQFRDSVHTGMDALTVVSDEANIQNAPGVKKANSELHSVGLGVMNLHGYLAKNHISY
ESEEAKDFADVFFMMMNYYSIERSMQIAKERGETFKDFDKSDYASGRYFERYTSEDFLPK
SEKVKALFANHTIPTRDDWKVLQAEVEKYGLYHAYRLAIAPTQSISYVQNATSSVMPIVD
QIERRTYGNSETFYPMPFLSPQTMWYYKSAFNIDQMKLIDLIATIQTHIDQGISTILYVN
SEISTRELSRLYVYAHHKGLKSLYYTRNKLLSVEECTSCAI
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactatggaacaaaaacaatacaagcacattgaacttaataatcaagtgacaaaa
agaaatgaaaatggcttttttcaacttgaaaaagatcaagaagcacttgcaagttattta
gaagagattcaagataaaactgttcattttgatagcgaacttgaacgccttcacttttta
gttgacaatcatttttattacaatgtatttgaagaatacagcgaagcgcaacttgttgaa
ttaattgcatttgcaacagagattccatttcgttttgctagttatatgtcagcaagcaaa
ttttttaaagactatgcattaaaaacgaatgataagtcacaatatctggaagactatcat
caacatgtaatgatagtgtcattttatcttgcaaaaggtaatgttgaacttgctaaaaaa
ttgattcaagcaatggtagagcaacgttaccaaccagcaacccctactttcttgaacgca
ggtcgtgcgcgtagaggtgaattagtttcatgtttcttattagaagtagatgacagttta
aactctattaattttattgattcaactgctaaacaattgagcaaaattggtggcggggta
gctattaacctttccaaattgcgtgcaagaggtgaagcgattaaaggcataaaaggtgtt
gcgaaaggggttttacctattgctaaagcacttgaaggtggttttagctatgctgatcaa
ttaggtcaacgtccaggtgctggggcagtgtatctaaatattttccactatgatgtagaa
gaatttttagatacgaagaaaattaacgcagatgaggatttgcgtctttcaacgatttca
acaggtctgattgtaccgtctaagtttttcgaattggcgaaagaaggtaaagatttcttt
atgtttgcccctcatacagtagaacaagaatatggcgtgactttagacgatattaatatt
gacgagtattatgatcgtcttgtcgaaaatccaaatatcatgaagaaaagtaaagatgca
cgtgaaatgttaaatatgattgcacaaacgcaattgcaatctggctacccttatttaatg
tttaaagataatgctaaccgtgtgcatgcaaattctaatattggccaaattaaaatgagt
aacttatgtacagaaattttccaacttcaagaaacatctgtgattcatgattatggcgta
gatgatgaaatcaaacgtgatatttcttgtaatctaggttcattaaatattgtgaatgtc
atggaatctaatcagtttagagattctgttcatacaggaatggatgcattaacagtcgta
agtgacgaagctaatattcaaaatgcaccaggcgtcaaaaaggcgaacagtgaactgcac
tcagttgggcttggtgtgatgaatttgcatggttatttagctaaaaatcatatcagttac
gaatcagaagaagcaaaagattttgcagatgtatttttcatgatgatgaattattattca
attgaacgttcgatgcaaattgctaaagaacgtggtgaaacattcaaagattttgataaa
tcggattatgcgagtggacgctattttgaacgctatacgtctgaggactttttaccaaag
tctgaaaaggtaaaagctctgtttgcaaatcacactattcctacacgtgacgattggaaa
gtattgcaagctgaagttgaaaaatatggcttatatcatgcataccgtttagcgattgca
ccaacacaaagtatttcgtatgtgcaaaatgcgacaagttcggtcatgccaattgtcgac
caaattgagcgacgtacatatgggaattcagaaacgttttaccctatgccgtttttatca
ccgcaaacaatgtggtattacaaatcagctttcaatattgatcaaatgaagctgatcgat
ttgattgcaacgatccaaacgcatattgaccaagggatttcaacaattctatatgttaac
tcagaaatttcaacgcgtgaattgtcacgtttatacgtttatgcgcatcataaaggtttg
aaatctttatactatacacgtaataaattattgagtgtcgaagaatgtacgagctgtgcg
atttaa

DBGET integrated database retrieval system