KEGG   Staphylococcus pseudintermedius ED99: SPSE_2454Help
Entry
SPSE_2454         CDS       T02008                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase F subunit, putative
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sdt  Staphylococcus pseudintermedius ED99
Brite
KEGG Orthology (KO) [BR:sdt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPSE_2454 (ahpF)
Enzymes [BR:sdt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPSE_2454 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 Thioredoxin_3 GIDA DAO FAD_oxidored Thi4 NAD_binding_8 AlaDh_PNT_C FAD_binding_3 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ADX77662
LinkDB All DBs
Position
2526907..2528430
Genome map
AA seq 507 aa AA seqDB search
MLNQELKQQLSQLLDLMEGDVVLKVSTGDDDHSQKMNDLVNEVSDMSSRITVEKAELKRT
PSFSINRPNEDTGITFAGVPLGHEFNSFVLALLQVSGRAPKEEQSVIDQIKSIDEPLHFE
TFISLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFKKEADDIMAVPAIFLNGEQFGNG
RMTVTDILSELGQGPDASEFENKETFDVLVVGGGPASASSAIYAARKGLKTGIVADRIGG
QVNDTADIENLIGVKKTTGPSLATSLEEHIKDYNVDIMTGVRAEGLEKTDDIVHLTLDNG
AVLKTRSLIIATGARWKKIGVPGEDTFANKGVAYCPHCDGPLFEGKDVAVIGGGNSGVEA
AIDLAGICKSVTVLEYGESLKADSVLQERLNSLPNTTVITHAATQEIKGDDRVSGIAYTC
NETNQEKHVDLNGVFVQIGLSPNTEWLGDTVQRNRMGEIEVDRLGNTNIPGVFAAGDCTD
QRYKQIIISMGSGATAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcaagaattaaagcaacaactttcacaacttcttgatttgatggaaggtgac
gttgttctgaaagtgagcactggcgatgacgatcattctcaaaaaatgaacgacctcgtt
aatgaagtttcagacatgtcatctcgaattacagtagaaaaagctgaattaaagcgtaca
cctagctttagtatcaacagaccaaacgaggacactggcattacatttgctggtgtccct
cttggtcatgagttcaattcttttgtcctagcactcttacaagtgagtggtcgtgcacca
aaagaagagcaatctgtaattgatcaaatcaagtctattgatgaaccccttcactttgaa
acattcattagcttaacatgtcaaaaatgtcctgatgtcgttcaagcattaaacttaatg
agtgtcatcaatccgaatataacacatacaatgattgatggtgccgttttcaaaaaagaa
gcagatgacattatggcggtacctgcaattttcttaaatggtgaacaattcggtaacggc
cgtatgacagtgacagacattcttagtgagttaggtcaaggtcctgacgcttctgaattt
gaaaataaagaaacatttgacgtcctcgtagtcggcggcggtcctgcaagtgcaagctct
gccatctatgctgcgcgtaaaggtttaaaaacaggtatcgtagcagacagaattggtggt
caagttaatgacacagctgatattgaaaacttaattggcgtgaagaaaacgacaggtcca
tcacttgcgacaagtcttgaagaacacattaaagactacaatgtggatattatgaccggc
gtacgtgcagaaggattagaaaaaacagatgatatcgttcatttgactttagataatggc
gcagtgcttaaaacgcgctcactcattatcgcaacaggtgcacgttggaagaaaatcggt
gtaccgggtgaagacacattcgcaaacaaaggtgttgcatactgcccgcactgtgacgga
cctctatttgaaggtaaagacgtcgctgttatcggtggcggtaactctggtgttgaagcc
gcgattgacttagcaggtatttgtaaaagtgtgacagtccttgaatatggtgagtcatta
aaagcagactctgtattacaagagcgtttaaattcattaccgaatacaacagtcatcaca
catgcagcaacacaagaaatcaaaggtgacgaccgcgtgagtggtattgcatacacttgt
aacgaaacaaatcaagaaaaacatgttgatttaaatggtgtcttcgttcaaatcggtctt
tctcctaatactgaatggttaggcgatactgttcaacgtaaccgcatgggtgaaattgaa
gtcgaccgtttaggaaacacgaacattcctggtgtctttgcggcaggcgactgtacagac
caacgctataaacaaatcattatttctatgggatcaggcgcaacagcagcattatctgca
ttcgactacctgattcgtaactaa

DBGET integrated database retrieval system