KEGG   Seriola dumerili (greater amberjack): 111216734Help
Entry
111216734         CDS       T05606                                 

Definition
(RefSeq) actin, cytoplasmic 2
  KO
K05692  actin beta/gamma 1
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04145  Phagosome
sdu04210  Apoptosis
sdu04510  Focal adhesion
sdu04520  Adherens junction
sdu04530  Tight junction
sdu04810  Regulation of actin cytoskeleton
sdu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111216734
  09143 Cell growth and death
   04210 Apoptosis
    111216734
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111216734
   04520 Adherens junction
    111216734
   04530 Tight junction
    111216734
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111216734
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111216734
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sdu03021]
    111216734
   03019 Messenger RNA biogenesis [BR:sdu03019]
    111216734
   03036 Chromosome and associated proteins [BR:sdu03036]
    111216734
   03029 Mitochondrial biogenesis [BR:sdu03029]
    111216734
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sdu04812]
    111216734
   04147 Exosome [BR:sdu04147]
    111216734
Transcription machinery [BR:sdu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     111216734
Messenger RNA biogenesis [BR:sdu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     111216734
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     111216734
    NuA4 complex
     111216734
  Chromatin remodeling factors
   BAF complex
    111216734
   PBAF complex
    111216734
   SWR1 complex
    111216734
Mitochondrial biogenesis [BR:sdu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    111216734
Cytoskeleton proteins [BR:sdu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     111216734
Exosome [BR:sdu04147]
 Exosomal proteins
  Proteins found in most exosomes
   111216734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 111216734
NCBI-ProteinID: XP_022594077
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MEDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgaaattgccgccctcgttgttgacaacggatccggtatgtgcaaagctggc
tttgcaggagatgatgctccacgtgctgtgttcccctccatcgttggacgtcccaggcat
cagggtgtgatggttggtatgggccagaaagacagctatgttggtgacgaggcacagagc
aaaaggggaatcctgactcttaagtaccccattgagcacggtattgtcaccaactgggat
gacatggagaagatctggcatcacaccttctacaacgagctgagagttgcccctgaggag
cacccagtcctgctcacagaggcccccctgaaccctaaggccaacagagaaaagatgacc
cagatcatgtttgagaccttcaacacccctgccatgtatgtggccatccaggctgtgctg
tccctgtacgcctcaggtcgtaccactggtattgtcatggactctggtgatggtgtgacc
cacacagtgcccatctatgaaggctacgccctcccccacgccatcctgaggttggacctg
gctggcagagacctcacagactacctcatgaagatccttactgagaggggctacagcttc
accaccacagctgagcgtgagattgtgcgtgatattaaggagaagctgtgttacgttgca
ctggactttgagcaagaaatgggaactgctgcctcctcctcatccctggagaagagctac
gagctgcctgacggacaggtcatcaccattggaaatgagaggttccgttgccccgaggct
ctcttccagccctctttccttggtatggagtcttgtggtatccatgaaactaccttcaac
agcatcatgaagtgtgatgtggacatccgtaaggacctgtacgccaacactgtgctgtct
ggtggtaccaccatgtaccctggcattgctgaccgtatgcagaaggaaatcactgccctg
gcacccactaccatgaagattaagatcattgctcccccagagaggaagtactctgtatgg
atcggagggtccatcctggcttccctgtccaccttccagcagatgtggatcagcaagcag
gagtatgatgagtctggccccagcattgtccacaggaagtgcttctaa

DBGET integrated database retrieval system