KEGG   Seriola dumerili (greater amberjack): 111216906Help
Entry
111216906         CDS       T05606                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00512  Mucin type O-glycan biosynthesis
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    111216906 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sdu01003]
    111216906 (galnt17)
Enzymes [BR:sdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     111216906 (galnt17)
Glycosyltransferases [BR:sdu01003]
 O-Glycan biosynthesis
  Mucin-type
   111216906 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 111216906
NCBI-ProteinID: XP_022594276
LinkDB All DBs
Position
Unknown
AA seq 599 aa AA seqDB search
MAFVFRRWRVLLVLNVLAVAGFMTFWAKCNTRSVQAAGPEAPADGKRPRGNGTGQGPSIS
HEVLLKRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPATLSPAEESDAKFLREKYG
YNAYLSDRISLDRTIPDHRPSKCRKVSYPRDLPQISLIFIFVNEALSVILRSVHSAVNHT
PAHLLKDIILVDDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARIEGWKVATA
EVTGFFDAHVEFTPSWAEPVLARIKEDHKRIILPSIDNIKHDTFEVERYENSGHGYNWEL
WCMYINPPKQWWDEGDMSAPIRTPAMIGCSFVANRDYFGELGLLDSGMDVYGGENIELGI
RVWLCGGSMEVLPCSRVAHIARIKKPYHSNIAFHTRRNALRVAEVWMDEYKSNVYLAWNI
PMENHGIDYGDVSQRVALRKSLQCKSFEWYLDNVYPEMRRYNNTLFYGEIRNSKVSHLCM
DQGMKENHTATLHPCHGWGPQLGRYTKEGQLFLGPLGSTGEDTRCVVDDQISSFPQLLNC
DKVTNVKQKTWHFSQNESIINRATGRCLEVVPANVYFGHLLVLQPCSGQRWTIKNTMKQ
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtgttcagaagatggagggtcttactggtgctgaacgtgcttgctgttgcc
gggttcatgactttttgggccaagtgcaacacacgcagcgtccaagccgccggtccggag
gctccggctgacgggaagaggccccggggtaacgggacggggcaggggcccagcatcagc
catgaggtgctgctgaagaggctgagctcgctggaggacgtggtgtacaggcagttaaac
ggtctgtccaaatctctgggcctgattgagggcttcgggggtcgggggaaaggcggcctc
cctgccacgctgtctccagctgaggagagcgatgctaaattcctgagggagaagtacggc
tacaacgcctacctgagtgacagaatctctctggatcggaccataccggaccaccggccc
agcaaatgcagaaaggtcagctacccgagggacctcccccagatctccctcatcttcatc
ttcgtcaacgaggctctgtccgtgatcctgcgctcagtccactcagctgtcaatcacacg
ccggcacacttgctcaaagacatcatcttggtggatgacaacagcgatgacgagcagctg
aagggacctctggaggagtatgtcaacaagcgctaccccggcctggtgaagatcgtcagg
aaccagaagagagagggactgatccgggccagaatcgagggctggaaggtggccactgcc
gaggtgacaggattttttgacgcccacgtggagttcacaccatcctgggctgagccggtt
ctggccagaataaaagaggaccacaagaggatcattttgccctccatcgacaacatcaag
cacgacacgttcgaggtggagcgctacgagaactcgggccatggctacaactgggagctg
tggtgcatgtacatcaacccgcccaaacagtggtgggacgagggcgacatgtccgctccc
atcaggactcccgccatgattggctgctccttcgtggccaaccgtgattacttcggggag
ctcggcctgctcgactctggcatggacgtttacggaggggagaacatcgaactgggcatc
agggtgtggctgtgtggaggcagtatggaggtgctgccttgttccagggtggctcacatc
gcgcggattaagaaaccctaccacagtaacatagctttccacacacggcgtaacgctctg
cgcgtggctgaggtctggatggatgagtacaaatccaatgtctacctggcctggaacatc
cccatggagaatcacggtattgattatggagacgtctctcagagagttgccctgaggaag
agtctgcagtgtaagagctttgagtggtacctcgacaatgtttacccagagatgaggagg
tacaacaacacactgttctatggagagattcgtaactctaaggtgagccacctgtgtatg
gatcagggcatgaaggagaaccacacggccaccctgcatccgtgtcacggatggggtcct
cagttaggacgttacaccaaagagggtcagctgttcctgggccccctgggcagcaccggg
gaggacactcgctgcgtggtggacgatcagatcagcagctttcctcagctccttaactgt
gacaaagtgaccaacgtgaagcagaagacatggcatttctctcagaacgaatccatcatt
aaccgtgccacggggcgctgtctggaggtggtgccggctaacgtttacttcggtcacctg
ctggtcctgcagccctgctccgggcagaggtggaccatcaagaacaccatgaagcagtag

DBGET integrated database retrieval system