KEGG   Seriola dumerili (greater amberjack): 111217141Help
Entry
111217141         CDS       T05606                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111217141 (sod1)
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     111217141 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 111217141
NCBI-ProteinID: XP_022594597
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVLKAVCVLKGAGETTGTVYFEQESDSAPVKLTGEIKGLTPGEHGFHVHAFGDNTNGCIS
AGPHFNPHNKNHAGPNDAERHVGDLGNVTAGADNVAKIDITDKMLTLNGPYSIIGRTMVI
HEKEDDLGKGGNEESLKTGNAGGRLACGVIGIAK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaaagctgtctgtgtgctgaaaggagctggagagaccaccgggacagtttat
tttgagcaggagagtgactcagcccctgtgaagctgacaggagaaatcaaaggtcttacc
cctggtgagcatggtttccatgtccatgcttttggagacaacaccaatgggtgcatcagt
gcaggacctcacttcaacccccacaacaagaatcatgcggggcctaatgatgcagagagg
catgttggagacctggggaatgtgactgctggagcagataatgttgccaagatagacatc
acggacaagatgctcaccctcaatggcccctactccatcattggccgaaccatggtgatc
catgagaaggaagatgacctgggaaaaggaggcaatgaagagagtctaaagacgggaaat
gctggtggccgtctggcctgtggagtcattggcatcgccaagtaa

DBGET integrated database retrieval system