KEGG   Seriola dumerili (greater amberjack): 111217719Help
Entry
111217719         CDS       T05606                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B-B-like
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00310  Lysine degradation
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111217719
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sdu03036]
    111217719
Enzymes [BR:sdu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     111217719
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111217719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 111217719
NCBI-ProteinID: XP_022595425
LinkDB All DBs
Position
Unknown
AA seq 963 aa AA seqDB search
MDGCTRMSVKELCETDDLATGLVLDPLLGFNTHKMNISPQPEIRRWGNLKETLLRFQRTH
DFNATFEALTVGELAGDYFNALGSHRQELLRQHVYRYLSAFLLDSGIKIESCDRYTSETN
GAKITSTRHWFAGERVEVLLGCIAELSPSDSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFVPGEKNIACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFRHRGKQPECEETKDPVGQKYRLRERYLRHHREKGHFPTRPIVPGIHSAIPSRNSFTQ
QMRRNALKNRKLNQTKKWRRVKHRRSGKHPLKSSTVKQRRTVPLLSQVTLRDVRIRVRRH
SLDFLLNCKDPKSKERALLQELENNGSEVNLKPSTLTSSMSVHQRSRPTVNSAGLNGKSV
RVADRQAVHTRTSSRTRSMAHTMLAQETGSTKDTSKDRNPPNPSFSFSALSNSDFTAKDR
NMSKNLGMRVSREDLRTQCLSVVGKPRLFGATSSSVTSQNPVTSTQPSINIKPSTSQSKA
QANLRTQGPFHRMTIPNKSQSFSSSSQPNTVRGLSQSSMTKSVPSSQMSNKFLSPQLFTV
KNHNPPDNPFNFHEKTSTVIHRVLKFQGGNQSQNLYSAPCKDTTAAGSPTVASRTLGTKS
GATEKTQQSLKLNIDSHHKANMSAQGFGKDVSHLGLSSNPNKSSPHFNKLNFPQSFSKNK
LSSDKHESGETNMTYKNFSALPRPFFFPSKMSDSYSTPEDRSLKHDKSTPSTSDKHQPCY
SQQDPFDFSFGSSLSPIPQHNSPQVVHSTPPGTPAPANKNMSSSASFPYGCQGPPYVLNF
SGDHSLTLGLRDGADGYPGLSSTNYTYHCLMEPSGTQGRLVLEPCGPQLSNQASFSLGGF
SGQRGQDEHYRKDMQQQCQPGEHQGAPHYGPVPTSHSMGATKPKRVRLVVTDGTVDLDLQ
YSD
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggacggatgcactagaatgagtgtgaaggagctgtgtgagactgatgacctggccacc
ggtttggtgctggaccctctgctgggcttcaacacccacaaaatgaacatcagtccccaa
ccagagatccggcgatggggtaaccttaaagagactctgttgcgatttcagcgtacgcac
gacttcaatgctacgtttgaggcgctgacagtaggcgaactggcaggggactacttcaat
gctttgggaagccatcgacaggagctgctgagacaacatgtgtatcggtacctcagtgcc
ttcctgttggatagtggtatcaaaatagagtcctgtgacagatacacctcagagaccaat
ggagcaaagataacctcaacacggcactggtttgcaggagagcgggtggaagtcttgctg
ggctgcatagcagaactgagcccctctgacagtgctgtgctgagggcgggagtcaatgac
ttcagtgtgatgtattccacacgcaagcgctgcgcccagctctggctcgggcctgcagct
ttcatcaaccatgactgcaaaccaaactgtaagttcgtccctggtgagaagaacatcgct
tgtgttgaagtgattcgaccaatctcacctggggaggagatcacgtgttactatggtgcc
agcttttttggcgagggcaatgaaatgtgtgaatgctgcacctgtgagaggaatggagag
ggtcacttcagacacagagggaagcagcctgaatgtgaagaaacaaaggaccctgtgggc
cagaagtaccgcttgagagagcgatatctccgccatcacagagagaagggtcactttcct
acgaggccgatagtaccaggaatacactcagccatcccctcaaggaattcctttacccag
cagatgaggagaaatgccttgaagaacagaaaactgaatcaaacaaagaagtggagacga
gtgaagcacagacggtcaggaaagcacccactaaaatcctccacagtcaaacaacgtagg
acagtcccgcttttgtcccaagttacactgagggacgtcagaatcagagtacggcgccac
tcactggatttcttactcaactgtaaggaccctaaaagcaaagaaagggccttgctgcaa
gaactagaaaataacggcagcgaggttaacttgaagccttccacactaacttcctccatg
tcggttcatcagaggagtagacccacagtaaacagtgctggtctcaatgggaagtccgtc
agagtggcggacaggcaggcagtccacacgaggacctcgtcaagaacaaggagcatggct
cacaccatgcttgcacaggagacagggtccacgaaggatacctccaaagacagaaaccca
cccaaccccagtttcagtttttcagctctcagcaactctgactttactgctaaggatcga
aacatgagtaaaaatctgggaatgagggtgtccagagaagacctcagaactcagtgtttg
tctgtagtcggcaagcctcggttgtttggagcaacatcatcttctgttacatctcaaaat
cctgttacctcaacccagccctccatcaacatcaagccgagcaccagccagtcaaaagcc
caggctaacctaagaacccagggccccttccatcgtatgaccattcctaataaatctcag
tcattttcaagtagtagtcagccaaacacagtaagaggactgtcccagagttccatgaca
aagtccgtcccatcatctcaaatgtctaacaaattcctctccccacagctcttcactgtg
aaaaatcacaatcctccagacaatccattcaacttccacgagaaaacctctacagttatt
cacagggtgcttaagttccagggggggaaccagagtcaaaacttatacagcgcaccctgt
aaagacaccacggctgctggcagcccgactgtcgcatccagaacactcggtacaaaatct
ggtgctactgagaagacccagcagagtctcaaactgaatatagacagtcatcataaagcc
aacatgtctgctcaaggctttggaaaagatgtcagccatcttggtttgtccagcaacccc
aacaagtccagccctcatttcaataaactcaacttccctcagtcttttagtaaaaataaa
ttgtcatctgataagcatgaaagtggagaaaccaacatgacgtacaaaaacttttctgcg
ctgccaagacccttcttctttcctagcaaaatgtctgacagttattcaacaccagaagac
aggagtctgaaacacgataaatccactccgtcgacctcagacaaacaccagccatgttac
tctcagcaagacccttttgatttcagctttggctcgtctctgtcccccattcctcagcac
aacagcccccaagtggtccacagtacacctcctggtacgccagcaccagcaaacaagaac
atgtcctcctcagcctctttcccctatggctgtcaaggtcctccttacgtactaaacttc
agtggagaccattcattgaccctgggtctcagggatggggctgatggttacccaggactc
agctcgacaaactacacctaccattgcctgatggagccttcaggcacacaagggcggctg
gttctcgagccctgtgggccccagctttcaaaccaagcgtctttttccttgggtggattt
tcagggcagaggggtcaggacgaacactacaggaaggacatgcagcaacagtgccagcct
ggggaacaccaaggtgcaccgcactatggacctgttccaacatctcactccatgggtgcc
acaaaacccaagagggtgaggttagtggtgacagacggcacagtagacttagatctccag
tactcggattga

DBGET integrated database retrieval system