KEGG   Seriola dumerili (greater amberjack): 111217746Help
Entry
111217746         CDS       T05606                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04210  Apoptosis
sdu04625  C-type lectin receptor signaling pathway
sdu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111217746
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111217746
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111217746
   04672 Intestinal immune network for IgA production
    111217746
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdu01001]
    111217746
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     111217746
Protein kinases [BR:sdu01001]
 Serine/threonine kinases: STE group
  Other
   111217746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 111217746
NCBI-ProteinID: XP_022595450
LinkDB All DBs
Position
Unknown
AA seq 858 aa AA seqDB search
MAVRQVRLFNSTAPFSGSPQADLKGSYTPCSAADQGTEEEEEEGKDSKMGYPHLTPRLNK
VLTHGTAEQVGKMPLKTTTIIAQASCETQDSQRFSPSDLSFPFVSSSPCSTSSLSSEHNN
VACPTTASVQELSNSSAQLKPSKKNRKRHKRREKKRLEKQEKQRHRHRMPSGVPEQESGS
SLVQIQESSSLGGRSSLSASRCSSIESSEERDRGPPLYSRQIYNTGSSCSPLNWREHVCG
PLSSLRSFEQDSVSDSLSSLGGYSLALAGLRGSVSQGDPCYARPFFKDVERDMREEEDEL
SEADSVSNEGIIFYNDKIQPVDSEYKEGREFVLSDFIKEGSYGEVHSAQDVNTGFRFAVK
KIALKRFSSEEVGAWSALRSPRVVELFGVVREGPNVFLFMEHKSGSLGQLIAERGRLPED
LSLHYHSQVLTALEYLVKKKVVHLDIKADNVLLSEDGRDTFLCDFGHAERLDNQGQSLSG
SNDLKGSETHMAPEIVKGEPRGAKADVWSSCCALLHMLNGCQPWTRYYTCRLYLKIANEP
PPLREIPPDCSPLTAEVLKAGLQKDPVKRASASDLKEKTDRALKEVGGLTSPVKGPYTDP
LYIANKPPDFLQLINSSVDFYDEEEHQESVEKVITAGGRREALDDDEEEEEKERGSPLCP
QMLISEPNHRRSSKITTVSELELRKLERDFYLSSLSQPQSAEMQVHLLSCLSNEAYSNWE
PWDKKDSGRWSLSPGDDFSSGVFSYSSQPDVQVFSMDLLGQTQLPPPCCFEGVDVCIRDF
SRRSIRIRETRRVKVGHIATGISDQISERVFTLETQQGLQIAHDEEVQESGLELCCVPAP
DFSPAWRWRIRDGVLETR
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaggcaggtgaggctcttcaactcaacagcaccattctccgggtcgccccag
gctgacctgaaggggtcgtacacaccatgctcggccgctgaccaggggacggaggaggag
gaggaggagggcaaggacagcaagatgggctacccgcatttaaccccaagactaaacaaa
gtcttgacacatggaactgcagaacaagtgggcaaaatgccattgaagaccacaaccatc
attgctcaggcttcatgtgaaacccaggactcccagaggtttagtccatctgacctctcc
ttcccctttgtttcctcctcaccctgctccaccagcagtctttcctcagagcacaacaac
gtggcatgcccaacaacggcctccgtccaggagctgagcaactcatcagcacagctgaaa
cccagcaagaagaacaggaagagacacaagcgtagagagaagaaaaggctggagaagcag
gagaagcagcgacacagacatcgaatgccttctggagtccctgaacaggagagtggaagt
tctctggtccagatccaggagtcgtcgtctctcggggggagaagcagtctcagtgcctct
cgctgtagcagcatcgaaagctcagaggagcgggacagagggcctcctctctacagccga
cagatttacaacacaggctccagctgctctccgctcaactggcgggagcatgtctgtggc
cccctctccagtctccggtccttcgagcaggacagcgtctcggactccctcagcagtttg
ggaggctactcgctggccctcgctggcctcaggggcagcgtcagtcagggggacccatgc
tatgcacggccctttttcaaagatgtggagcgggacatgagagaagaggaagatgagctc
tcagaagccgattctgtcagtaacgagggaatcatcttttacaacgataaaattcagcct
gtggactctgagtacaaggaagggagggagtttgtcctctcagatttcatcaaggagggc
tcctatggcgaagtgcacagcgctcaagatgtcaacacgggcttcagatttgctgtcaaa
aagatcgccctgaagaggttcagcagtgaggaggtgggtgcgtggagtgccctcagatct
cctcgcgtggtggagctctttggagtggtcagagaggggcctaatgttttcctcttcatg
gagcacaaatctggctctctaggccagctgatagccgagcgtggccggctgccagaggac
ttaagcctccactaccactcacaagtcttaacagcactggagtacttggttaagaaaaaa
gtggtgcacctagatattaaagctgacaacgtgttgctgtcggaggacggtagagacact
ttcctgtgtgactttggacatgcagagagactggacaaccaggggcagagcctcagtggg
tccaatgatctgaagggcagcgagacccacatggcccctgagatcgttaaaggggaaccc
cgcggagccaaagcagatgtgtggagcagctgctgtgcgttactgcacatgctcaacggg
tgtcaaccttggacaagatactacacctgtagactttacctgaagatcgccaacgagcca
ccgcctttgagagagatcccgcccgactgtagcccgctcacggctgaagttctgaaggca
ggactccagaaggatccggtcaagagagcatcagcatctgacctcaaagaaaaaactgac
agagctctgaaagaagttggaggactcaccagcccagtgaagggaccctacaccgacccc
ctgtatatcgccaacaaacctcctgacttccttcaactcatcaatagcagcgttgacttt
tacgatgaggaggaacatcaggagtctgttgagaaagtgatcacggcaggggggaggagg
gaggcactggatgatgatgaagaagaagaagagaaggagcgaggctcgccactctgtcca
caaatgctgatctctgagccaaaccacaggaggagcagcaagataaccactgtgtctgaa
cttgagctacgtaaactggagcgagatttctacctgagcagtttgtcccagcctcagtct
gctgagatgcaggtgcaccttttgtcttgtctcagcaatgaagcttattcaaattgggaa
ccatgggacaaaaaggactctggccgctggtccctgagcccaggagatgacttcagctct
ggtgtcttctcctacagcagtcagccagatgtgcaggtcttcagcatggatttgctgggt
caaacacagctaccaccaccctgttgttttgaaggggtggatgtctgcatcagagacttc
agcaggagaagcatccgaatcagagagacacgccgggtgaaggtgggccacatcgccact
gggatcagtgatcagatctccgagagagttttcactctggagacccagcagggcctgcag
atcgctcacgacgaggaggtgcaggagtccggtctggagctctgctgtgttcccgctcca
gacttcagccccgcatggaggtggaggatcagagacggggtgctggagacaagatag

DBGET integrated database retrieval system