KEGG   Seriola dumerili (greater amberjack): 111219285Help
Entry
111219285         CDS       T05606                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00010  Glycolysis / Gluconeogenesis
sdu00030  Pentose phosphate pathway
sdu00051  Fructose and mannose metabolism
sdu00052  Galactose metabolism
sdu01100  Metabolic pathways
sdu01200  Carbon metabolism
sdu01230  Biosynthesis of amino acids
sdu03018  RNA degradation
Module
sdu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111219285
   00030 Pentose phosphate pathway
    111219285
   00051 Fructose and mannose metabolism
    111219285
   00052 Galactose metabolism
    111219285
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111219285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sdu01009]
    111219285
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sdu03019]
    111219285
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111219285
Protein phosphatases and associated proteins [BR:sdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111219285
Messenger RNA biogenesis [BR:sdu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111219285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111219285
NCBI-ProteinID: XP_022597635
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MSQNVNPTADPTKMGLGRSIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVYFVHEGYQGL
VDGGDNIRPATWESVSMMLQLGGTVIGSARCKDFREREGRMKAALNLVKLGITNLCVIGG
DGSLTGANQFRTEWSGLLVDLVKAGRITDAEAKKSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPDEG
WENHLCRRLTDQRARGSRLNVIIVAEGAMSREGKPITSEQIKKLVTDRLGFDTRTTTLGH
VQRGGTPSAFDRILGSRMGVEAVMALLEATPDTPACVVSLSGNQAVRLPLMECVQVTKDV
TAAMAEGRFDDAIKLRGKSFENNWNTYKLLAHINPPDVKSNINVAVMNIGAPCAGMNAAV
RAAVRMGLIQGHNMLAVHDGFDGLAHGQVEPITWTAVSGWTGKGGSMLGTKRTLPAKILE
EISQNIAKFNIHALVIIGGFEAYVGGLELVQAREKYEEMCIPMVVIPATVSNNVPGSDFS
IGADTALNTITATCDRIKQSAAGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIFEDK
FNIKDLEVNVEHLVAKMKTTVKRGLILRNENSNSNYTTDFIFNLYSEEGKGIFDCRKNVL
GHMQQGGTPTPFDRNFGTKMGAKSVLWLTEKLKECYRHGRIFANTPDSACVLGMRKRALT
FQPLAELKGDTDFEHRIPKTEWWLKIRPIMKILAKYNIKLDTSEHTDMEHVIKKRSPLGK
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaatgtcaatccaaccgcggaccccacaaagatggggcttggacggtccatt
gccgtgctgacgtcaggaggagacgcccaaggtatgaacgccgctgtgagagccacagtc
agagttggtctttacaccggagccaaagtctactttgttcacgagggataccagggcctg
gtggatggaggggataacattcgcccggccacgtgggagagtgtgtccatgatgcttcag
ctgggaggtacagttatcggcagtgcccgctgcaaggacttcagagagagggagggtcgt
atgaaggctgccctcaacctggtgaagctgggcatcaccaacctgtgtgtgatcggaggt
gacggtagtctgaccggagccaaccagttcaggactgagtggagcggactgctggttgac
ctggtcaaagctggaagaattacagatgcagaagccaagaaatcttcccacctgaacatt
gttggcatggtcggctccatcgacaatgacttctgtggcactgacatgacaatcggcact
gactccgccctgcaccgcatcatcgaggtggtggatgccatcacaacaacagcacagagc
caccagaggacgttcatcctggaagtgatgggcagacactgtgggtacctggccctggtg
acggctctggcctgtggcgccgactgggtgttcattccagagatgccaccagatgagggc
tgggagaaccacttgtgcaggaggctgacagaccaaagggcccgaggttctcgtctgaat
gtgatcattgtagctgagggtgcgatgtccagagaaggcaaaccgattacatctgaacag
attaaaaagctggtgactgacaggctcggcttcgacactcgcaccactactctaggacac
gtacagagaggtggcacaccctccgccttcgacagaatcctgggcagcaggatgggagtg
gaggccgtgatggcgctgctggaggccactccagacactcctgcctgtgtggtcagcttg
tccgggaaccaggcggtcagactgccgctcatggagtgtgtgcaagtgaccaaagatgtg
actgcagccatggctgagggcagattcgatgatgctatcaagctcagaggaaagagtttc
gagaacaactggaacacatacaaacttctggctcacatcaaccccccagatgttaagagt
aacatcaatgtggccgtcatgaacatcggagccccctgtgctggtatgaacgctgcagtc
cgtgcagcagtcaggatgggcctcatccagggtcacaacatgttggctgtccatgacggc
tttgacggtctggctcatggacaggttgagcccatcacctggactgcagtcagtggctgg
actggaaagggaggctcaatgttgggcaccaagagaactctgccggctaaaatactggag
gaaatcagccagaacatcgccaagttcaacatccacgctttggtgatcatcggtggattt
gaggcctatgtgggaggcctggagctggttcaggccagggagaaatatgaggagatgtgc
attcccatggtggttatccccgccaccgtctccaacaacgtccctggctccgacttcagc
atcggcgctgacacggccctcaacaccatcaccgcgacctgtgacaggatcaagcagtct
gcagcaggaactaaacgccgcgtgttcatcgttgagactatgggtggttactgcggctac
ctggccaccatggctggtctggctgccggggctgacgctgcctacatctttgaggacaaa
ttcaacattaaagacctggaggtgaatgtagagcatcttgtggcgaagatgaagacaaca
gtgaagagaggtttgattctcaggaacgagaactctaattccaactacaccaccgacttc
atcttcaacctgtactcagaggagggcaaaggtatcttcgactgccgtaagaatgttctg
gggcacatgcagcagggtggcactccaacgcccttcgacagaaactttggcacaaaaatg
ggagccaagtctgtcttgtggctgactgagaaactcaaggagtgctataggcatggccgt
atcttcgctaacacaccagactctgcctgtgtgctgggcatgaggaagagggcgctcacc
ttccagccacttgctgaactgaagggagacacagattttgagcaccgcatcccaaagaca
gagtggtggctgaagattaggcccatcatgaagatcctggccaagtacaacatcaaatta
gacacatccgaacacactgatatggagcatgtgatcaagaagaggagtcctcttgggaag
tag

DBGET integrated database retrieval system