KEGG   Seriola dumerili (greater amberjack): 111219627Help
Entry
111219627         CDS       T05606                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00590  Arachidonic acid metabolism
sdu01100  Metabolic pathways
sdu04370  VEGF signaling pathway
sdu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111219627 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    111219627 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111219627 (ptgs2)
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     111219627 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 111219627
NCBI-ProteinID: XP_022598095
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MNRLTFAVLLLALGFLVCEGGNPCCSEPCQNRGVCTALGTDNYECDCTRTGYHGQNCTTP
EFLTWIKMSLKPSPNTIHYLLTHFKGFWNIINNISFLRDAIMRYVLTSRSHMIDSPPTYN
ADYGYKNWEAYSNLSYYTRTLPPVPEDCPTPMGVVGKKELPDAKLLAEKLLMRRQFIPDP
QGTSLMFAFFAQHFTHQFFKSDMKKGPAFTQAKGHGVDLNHIYGDNLERQHKLRLFKDGK
LKHQILDGEMYPPTVKEVGVDMHYPPHVPDSHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPDWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRF
QYQNRIASEFNTLYHWHPLMPDTFHIEEKDYNYKQFVFNTSVVTEHGIGNLVESFTNQIA
GRVAGGRNVPGPIMYVAIKSIENSRQMRYQSLNAYRKRFNMKPYSSFEDMTGEKEMAALL
EEMYGHVDAVELYPGLLVEKPRANAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFG
GSAGFDIINTASLQRLVCNNVRGPCPVASFHVPNIKETGSMIINSSTSHSGGSDINPTVI
LKERTTEL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaacagactcacatttgcggttctcctgttggccctggggtttcttgtgtgcgaagga
ggtaacccatgttgctcagagccatgccagaacaggggtgtttgcacagcactgggaaca
gataattatgagtgtgactgcactcgcacaggatatcatggacaaaactgcacaacacct
gagttcctcacctggatcaaaatgtccctgaagccatcgccaaacaccatccactacctt
ctcacccacttcaagggcttctggaacatcatcaacaacatctcatttctccgggatgcc
atcatgagatatgtgctgacatcccgatcccacatgattgatagtcctccaacctacaat
gcagattatggttacaaaaactgggaagcttattccaacctttcttactatacgcgcacc
ctcccccctgtgccagaggattgcccaacccccatgggagtagtaggtaaaaaggagcta
cctgatgcaaaacttttggctgagaagctcctgatgaggaggcagttcatcccggaccct
cagggcaccagtctgatgtttgcgttcttcgcgcagcatttcacccaccagttcttcaaa
tctgatatgaagaaaggacctgcttttacccaggccaaaggtcatggggtggatctcaac
cacatttatggagacaacctggagaggcaacacaagctcagactcttcaaggacggcaag
cttaaacatcagatcctggatggagagatgtaccccccaacagtaaaggaagtgggtgtc
gacatgcactaccctcctcatgtccccgactctcaccgcttcgctgtgggccacgaggca
ttcggcctggtccctggtctgatgatgtacgccaccatttggctgcgggaacacaaccgg
gtgtgtgatgtgttgaaggaggtacaccccgactgggatgacgaaagactcttccagacc
acacggctcatcctgattggtgagaccatcaagattgtgatcgaggactacgtgcagcac
ctgagtggctatcacttcaagctcaagtttgaccctgagctgctcttcaaccagcgtttc
cagtaccagaaccgcattgcttcagaattcaacaccctgtaccactggcacccgctgatg
cctgatactttccacattgaggagaaagattacaactacaaacagtttgtcttcaacacc
tctgtagtgactgagcatggcatcggcaacctggtggagtcatttaccaaccagattgct
ggacgggttgctggtggccgtaatgtccctggacctatcatgtacgtggccattaagtcc
atagaaaacagcagacaaatgcgttaccagtctctgaatgcctacaggaaacggttcaac
atgaagccctacagctcttttgaggacatgacaggagagaaagaaatggccgcactgctg
gaggagatgtacggacatgtcgacgctgtggagctctacccaggcctgctggtggaaaaa
cccagggctaatgccatctttggggagaccatggtggagatgggagcccctttctccctc
aagggcttaatgggaaaccccatctgctccccggagtactggaagcccagcaccttcgga
ggcagcgcgggctttgacatcatcaacactgcctccctgcagaggctcgtctgcaataac
gtgcggggtccatgtcccgtggcatcctttcatgtgcccaacatcaaagagacgggatcc
atgatcatcaactcaagcacgtcccactcaggcggcagtgacataaaccctacagtcatt
ttgaaagaaaggactactgagctctaa

DBGET integrated database retrieval system