KEGG   Seriola dumerili (greater amberjack): 111220318Help
Entry
111220318         CDS       T05606                                 

Definition
(RefSeq) uncharacterized protein LOC111220318
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sdu01002]
    111220318
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     111220318
Peptidases [BR:sdu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111220318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 111220318
NCBI-ProteinID: XP_022599093
LinkDB All DBs
Position
Unknown
AA seq 2071 aa AA seqDB search
MALKKWFCVLTLASLLPAESHAQLDVCGTAPLNTRIVGGEDAPPGSWPWQVSLQRFGRHV
CGGSLINREWVMSAAQCFSSTSTFGWQVSLGRQNLQGTNPNEVSRTVARIILHPNYDSDS
SDNDIALLRLSSPVMFTDYIRPVCLAASDSVFNNGTDSWVTGWGRVNEGVSLPFPQTLQE
VEVPVLGNRQCNCLNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVS
FGFGCARPNLPGVYSRVSRYQSWINSFISSDKPGFVQFSSSGPDADSSYTCPGLPPPLIT
TTTTTAGPATPTDSPSTVSSAELCGITPLNTRIVGGEDAPPGSWPWQVSLQRFGGHVCGG
SLINREWVMSAAHCFSSTSTSGWQVSLGRQNLQGTNPNEVSRTVARIILHPNYDSDSSDN
DIALLRLSSPVMFTDYIRPVCLAASDSVFNNGTDSWVTGWGRVNEGVSLPFPQTLQEVEV
PVLGNRQCNCLNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGF
GCARPNLPGVYSRVSRYQSWINSFISSDKPGFVQFSSSGPDADSSYTCPGLPPPLITTTT
TTAGPATPTDSPSTVSSAELCGITPLNTRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLI
NREWVMSAAHCFSSTSTSGWQVSLGRQNLQGTNPNEVSRTVARIILHPNYDSDSSDNDIA
LLRLSSPVMFTDYIRPVCLAASDSVFNNGTDSWVTGWGRVNEGVSLPFPQTLQEVEVPVL
GNRQCNCLNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCA
RPNLPGVYSRVSRYQSWINSFISSDKPGFVQFSSSGPDADSSYTCPGLPPPLITTTTTTA
GPATPTDSPSTVSSAELCGITPLNTRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLINRE
WVMSAAHCFSSTSTSGWQVSLGRQNLQGTNPNEVSRTVARIILHPNYDSDSSDNDIALLR
LSSPVMFTDYIRPVCLAASDSVFNNGTDSWVTGWGRVNEGVSLPFPQTLQEVEVPVLGNR
QCNCLNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPN
LPGVYSRVSRYQSWINSFISSDKPGFVQFSSSGPDADSSYTCPGLPPPLITTTTTTAGPA
TPTDSPSTVSSAELCGITPLNTRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLINREWVM
SAAHCFSSTSTSGWQVSLGRQNLQGTNPNEVSRTVARIILHPNYDSDSSDNDIALLRLSS
PVMFTDYIRPVCLAASDSVFNNGTDSWVTGWGRVNEGVSLPFPQTLQEVEVPVLGNRQCN
CLNGVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPG
VYSRVSRYQSWINSFISSDKPGFVQFSSSGPDADSSYTCPGLPPPLITTTTTTAGPATPT
DSPSTVSSAELCGITPLNTRIVGGEDAPPGSWPWQVSLQRFGGHVCGGSLINREWVMSAA
HCFSSTSTSGWQVSLGRQNLQGTNPNEVSRTVARIILHPNYDSDSSDNDIALLRLSSPVM
FTDYIRPVCLAASDSVFNNGTDSWVTGWGRVNEGVSLPFPQTLQEVEVPVLGNRQCNCLN
GVGTVTDNMICAGVLAGGKDSCQGDSGGPMVSKQGSVWVQSGIVSFGFGCARPNLPGVYS
RVSRYQSWINSFISSDKPGFVQFSSSGPDADSSYTCPGLPPPPATSPTTRPTITTQSVAS
PARSVCGKAPMNSRSTGDSSVVPGGMWPWMVSLHRNGVYTCGGTLIADKFVLTSGQCFST
LNPNVREWSVFLGHRRVNDFEEFEMSLDVVNITLSKMPGSNIALLQLDKPVSYSDYIQPA
CVDISNDRSFPIGSPCWVAGWGKGSKSRGTDKDGSGLRDLETQVASCGNFSDSENICTYT
MDLQQGDTGSPLLCKSDSSWFQVAVVTMSGSKSVRADIQVFAKTSRFGSFLKETVGDMPS
PAAAATGNAPGFTISLFFAFTVPISSMFLLL
NT seq 6216 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaagaaatggttctgcgtattgaccctggcgagtcttttgcctgcagaatca
catgctcagcttgatgtatgtggcactgctcccctgaacaccaggatagttggaggtgaa
gatgctccacctggaagttggccctggcaggtcagtctgcagaggtttggccgccatgtt
tgtggcggttccctcatcaacagagagtgggtgatgtctgctgctcagtgcttttccagt
acaagtacgtttggatggcaggtttctctgggccgtcagaacctgcagggcacaaaccca
aatgaagtgtccagaactgttgccagaatcattttacatccaaactatgacagcgacagc
agcgacaacgacattgctctgctcagactctcctcaccagtcatgttcacagactacatc
agacctgtgtgtctggcagccagtgacagtgtgttcaacaacggtactgacagctgggtc
actggctggggcagagtcaacgagggagtgtctttaccgttccctcaaactctacaagag
gtggaggtgccagttctgggaaacagacagtgtaactgtctcaatggagtcggtacagtc
acagacaacatgatctgtgctggtgttctggcaggaggcaaagactcatgtcagggtgac
tcaggaggtccaatggtgagcaaacagggctccgtgtgggtccagtctggaatagtcagt
tttggttttggctgcgctcgtcccaatctgccaggagtctactccagagtgtcccgctac
cagtcctggatcaactccttcatcagctctgataagccaggctttgtccagttcagctcc
agtgggccggatgctgacagcagctacacctgtcctggtctcccacctcctctcattact
actactactactactgcaggaccagctacacccacagattcaccatccactgtatcaagt
gctgaattgtgtggcatcactcccctgaacaccaggatagttggaggtgaagatgctcca
cctggaagttggccctggcaggtcagtctgcagaggtttggcggccatgtttgtggcggt
tccctcatcaacagagagtgggtgatgtctgctgctcactgcttctccagtacaagtacg
tctggatggcaggtttctctgggccgtcagaacctgcagggcacaaacccaaatgaagtg
tccagaactgttgccagaatcattttacatccaaactatgacagcgacagcagcgacaac
gacattgctctgctcagactctcctcaccagtcatgttcacagactacatcagacctgtg
tgtctggcagccagtgacagtgtgttcaacaacggtactgacagctgggtcactggctgg
ggcagagtcaacgagggagtgtctttaccgttccctcaaactctacaagaggtggaggtg
ccagttctgggaaacagacagtgtaactgtctcaatggagtcggtacagtcacagacaac
atgatctgtgctggtgttctggcaggaggcaaagactcatgtcagggtgactcaggaggt
ccaatggtgagcaaacagggctccgtgtgggtccagtctggaatagtcagttttggtttt
ggctgcgctcgtcccaatctgccaggagtctactccagagtgtcccgctaccagtcctgg
atcaactccttcatcagctctgataagccaggctttgtccagttcagctccagtgggccg
gatgctgacagcagctacacctgtcctggtctcccacctcctctcattactactactact
actactgcaggaccagctacacccacagattcaccatccactgtatcaagtgctgaattg
tgtggcatcactcccctgaacaccaggatagttggaggtgaagatgctccacctggaagt
tggccctggcaggtcagtctgcagaggtttggcggccatgtttgtggcggttccctcatc
aacagagagtgggtgatgtctgctgctcactgcttctccagtacaagtacgtctggatgg
caggtttctctgggccgtcagaacctgcagggcacaaacccaaatgaagtgtccagaact
gttgccagaatcattttacatccaaactatgacagcgacagcagcgacaacgacattgct
ctgctcagactctcctcaccagtcatgttcacagactacatcagacctgtgtgtctggca
gccagtgacagtgtgttcaacaacggtactgacagctgggtcactggctggggcagagtc
aacgagggagtgtctttaccgttccctcaaactctacaagaggtggaggtgccagttctg
ggaaacagacagtgtaactgtctcaatggagtcggtacagtcacagacaacatgatctgt
gctggtgttctggcaggaggcaaagactcatgtcagggtgactcaggaggtccaatggtg
agcaaacagggctccgtgtgggtccagtctggaatagtcagttttggttttggctgcgct
cgtcccaatctgccaggagtctactccagagtgtcccgctaccagtcctggatcaactcc
ttcatcagctctgataagccaggctttgtccagttcagctccagtgggccggatgctgac
agcagctacacctgtcctggtctcccacctcctctcattactactactactactactgca
ggaccagctacacccacagattcaccatccactgtatcaagtgctgaattgtgtggcatc
actcccctgaacaccaggatagttggaggtgaagatgctccacctggaagttggccctgg
caggtcagtctgcagaggtttggcggccatgtttgtggcggttccctcatcaacagagag
tgggtgatgtctgctgctcactgcttctccagtacaagtacgtctggatggcaggtttct
ctgggccgtcagaacctgcagggcacaaacccaaatgaagtgtccagaactgttgccaga
atcattttacatccaaactatgacagcgacagcagcgacaacgacattgctctgctcaga
ctctcctcaccagtcatgttcacagactacatcagacctgtgtgtctggcagccagtgac
agtgtgttcaacaacggtactgacagctgggtcactggctggggcagagtcaacgaggga
gtgtctttaccgttccctcaaactctacaagaggtggaggtgccagttctgggaaacaga
cagtgtaactgtctcaatggagtcggtacagtcacagacaacatgatctgtgctggtgtt
ctggcaggaggcaaagactcatgtcagggtgactcaggaggtccaatggtgagcaaacag
ggctccgtgtgggtccagtctggaatagtcagttttggttttggctgcgctcgtcccaat
ctgccaggagtctactccagagtgtcccgctaccagtcctggatcaactccttcatcagc
tctgataagccaggctttgtccagttcagctccagtgggccggatgctgacagcagctac
acctgtcctggtctcccacctcctctcattactactactactactactgcaggaccagct
acacccacagattcaccatccactgtatcaagtgctgaattgtgtggcatcactcccctg
aacaccaggatagttggaggtgaagatgctccacctggaagttggccctggcaggtcagt
ctgcagaggtttggcggccatgtttgtggcggttccctcatcaacagagagtgggtgatg
tctgctgctcactgcttctccagtacaagtacgtctggatggcaggtttctctgggccgt
cagaacctgcagggcacaaacccaaatgaagtgtccagaactgttgccagaatcatttta
catccaaactatgacagcgacagcagcgacaacgacattgctctgctcagactctcctca
ccagtcatgttcacagactacatcagacctgtgtgtctggcagccagtgacagtgtgttc
aacaacggtactgacagctgggtcactggctggggcagagtcaacgagggagtgtcttta
ccgttccctcaaactctacaagaggtggaggtgccagttctgggaaacagacagtgtaac
tgtctcaatggagtcggtacagtcacagacaacatgatctgtgctggtgttctggcagga
ggcaaagactcatgtcagggtgactcaggaggtccaatggtgagcaaacagggctccgtg
tgggtccagtctggaatagtcagttttggttttggctgcgctcgtcccaatctgccagga
gtctactccagagtgtcccgctaccagtcctggatcaactccttcatcagctctgataag
ccaggctttgtccagttcagctccagtgggccggatgctgacagcagctacacctgtcct
ggtctcccacctcctctcattactactactactactactgcaggaccagctacacccaca
gattcaccatccactgtatcaagtgctgaattgtgtggcatcactcccctgaacaccagg
atagttggaggtgaagatgctccacctggaagttggccctggcaggtcagtctgcagagg
tttggcggccatgtttgtggcggttccctcatcaacagagagtgggtgatgtctgctgct
cactgcttctccagtacaagtacgtctggatggcaggtttctctgggccgtcagaacctg
cagggcacaaacccaaatgaagtgtccagaactgttgccagaatcattttacatccaaac
tatgacagcgacagcagcgacaacgacattgctctgctcagactctcctcaccagtcatg
ttcacagactacatcagacctgtgtgtctggcagccagtgacagtgtgttcaacaacggt
actgacagctgggtcactggctggggcagagtcaacgagggagtgtctttaccgttccct
caaactctacaagaggtggaggtgccagttctgggaaacagacagtgtaactgtctcaat
ggagtcggtacagtcacagacaacatgatctgtgctggtgttctggcaggaggcaaagac
tcatgtcagggtgactcaggaggtccaatggtgagcaaacagggctccgtgtgggtccag
tcaggaatagtcagttttggttttggctgcgctcgtcccaatctgccaggagtctactcc
agagtgtcccgctaccagtcctggatcaactccttcatcagctctgataagccaggcttt
gtccagttcagctccagtgggccggatgctgacagcagctacacctgtcctggtctccca
cctcccccagcaacttcaccaacaacgaggccaactattaccacccaaagtgtagccagt
cctgcaaggtcagtgtgtggcaaagctcccatgaacagtcgttctactggtgacagtagt
gtagtgccaggaggaatgtggccctggatggtgagtctccacagaaatggggtctacact
tgtggaggaaccctcatcgctgataaatttgtcctcaccagtggccagtgcttctctacc
ctcaatccaaatgtccgggagtggagcgtgtttctcggccacagacgcgtaaacgatttt
gaggaatttgagatgtctctggatgtcgtcaacattacattgagcaaaatgccgggctcc
aatattgctctgctgcagctggataaaccagtcagctacagtgattatatccagcctgcg
tgtgtggacattagcaatgacagatccttccccattggtagcccatgctgggtggcaggc
tgggggaaggggagtaagagcagaggtaccgataaagatggctcaggtcttcgagacctt
gaaactcaagtggcaagttgtgggaacttttctgattcggagaacatttgcacttatacc
atggaccttcagcagggggatacgggcagccctctactgtgcaagtcggactcatcttgg
ttccaggtggccgttgtaacaatgagcggaagtaaatcagtccgtgcagacattcaggtc
tttgcaaagacttcaagatttgggtcgttcttgaaggagacagttggtgacatgccctct
cctgcagcagctgcaacaggaaatgcaccaggtttcacaatttccttattctttgctttc
actgtccccatttcttccatgttcctgttgttgtga

DBGET integrated database retrieval system