KEGG   Seriola dumerili (greater amberjack): 111220374Help
Entry
111220374         CDS       T05606                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sdu01002]
    111220374 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdu04147]
    111220374 (ace)
   04090 CD molecules [BR:sdu04090]
    111220374 (ace)
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     111220374 (ace)
Peptidases [BR:sdu01002]
 Metallo Peptidases
  Family M2
   111220374 (ace)
Exosome [BR:sdu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111220374 (ace)
CD molecules [BR:sdu04090]
 Proteins
  111220374 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 111220374
NCBI-ProteinID: XP_022599164
LinkDB All DBs
Position
Unknown
AA seq 1286 aa AA seqDB search
MGTTVDRFLWSVLLLLPVLGLSVALPANWLPGEYSNTTADALAFLSDYNTTAEQVLFHSV
SASWNYNTNLTDHNSKLQIQASLEEQAFSEAWGLKAKQVFTRELLDSLPDPTDAKLMEKI
MTLGAANLPPKEREEYNTILSTMDNIYSTAKVHPEPNISWSLEPHLTDIMANSRSYKRLL
YVWEGWHNASGVPLKQHYPKFVELSNKASQADGFADTGADWRSWYETETFEEDLEKLYRT
IEPLYQNLHAFVRRQLYKQYGPKYINLKGPIPAHLLGNMWAQTWNNIYGMMIPFPNKPNM
DVTDEMVRQGYNATNMFRVAEEFFTSLGLEPMPQEFWDESMLEKPEGREVVCHASAWDFY
NRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGYRRGANPGFHEAIGDVLSLS
VSTPKHLHTINLLDSVVSDEETDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRTPPER
YNSEWWYLRTKYQGICQPTGRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKLCQA
ANHTGPLHTCDIYRSAEAGAILKKVLQAGSSKPWPVVLQEAIGTNKMDASSLMKYFDPII
QWLKKQNVNETLGWPDFNWVPPVPEGYPGDIDKNTDELDAKKFLDEYNSTAEGVWNAYTE
ASWKYNTDINEANKQEMLKKNLEMSAHTLKYGQKARQYDTTDFQDPSVKRIIKKLSDIER
AALPTTQLEEYNTLLSNMETKYSVAEVCRDNGTCHPLDPDLQKIMAESRDYDELLFAWKG
WRDAAGKVLRQDYKRYVELANKAATLNGHSDNGAFWRSLYETPTFEQDLESLWKELEPLY
QNVHAYVRRALYKKYGPKYINLKGPIPAHLLGNMWAQTWSGIMDLVMPFPSATQVDATPA
MVAKNWNATVMFQESDRFFTSLGLKPMPEEFWKKSMLVKPSDGRQVVCHASAWDFYNRKD
FRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTP
KHLQSIGLLDKVEANVESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPQDEYNKE
WWNLRMKYQGLCPPVVRTEDDFDPGAKFHIPANVPYVRYFVSFIVQFQFHKALCEAANHV
GPLHTCDIYKSTDAGKLLGDVMKLGFSKPWPEAMTMITGQPKMSAQPLMQYFQPLIDWLE
KENNKNNDIRGWPEYDWKPSTTGEVKANKVDFLGMSVDSSAALAGQWVLLVIGLVLLLAT
ILLAYKYRKSRRPEKSLSTMELKQKD
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atgggcactactgtggacaggtttctgtggtctgtgctgctgctgctgccagtcttagga
ctcagtgtggctctgccagcaaactggcttccaggggaatattcaaataccacggctgat
gcactggcgttcctcagtgactacaacaccactgccgagcaggtgttattccacagcgtc
tctgccagctggaactacaacaccaacttaacagaccacaactccaagcttcagatacaa
gcatcccttgaggagcaggcgttctctgaagcctgggggttaaaggccaagcaggtcttc
acccgcgagcttctcgactctctccccgaccccacagacgcgaagctgatggaaaagatc
atgaccctgggagccgccaatctgcccccgaaagagagagaggagtacaacaccattctc
agcaccatggataatatctattcaacagccaaggtgcatccagaaccaaacataagctgg
agccttgaacctcatctcacagatatcatggccaactccaggagctacaagagactgctg
tacgtctgggagggctggcacaatgcgtcaggcgtacctctcaagcagcactaccccaag
tttgtggagctcagcaacaaagcgtctcaagctgatggatttgccgacactggagctgac
tggcggtcttggtatgagactgagacctttgaggaggatttggagaaactctacagaacc
attgagcctctttaccagaacctgcatgcctttgtgcgccgccagctctacaaacagtac
ggtcccaagtacatcaacctgaaaggacctattcctgcccacctactaggaaatatgtgg
gcccagacctggaacaatatttatggtatgatgatcccatttcctaacaaacccaacatg
gatgtgactgatgaaatggtcagacaaggctacaatgccacaaacatgtttcgtgtagcc
gaggagttcttcacctctctaggtttagagccgatgcctcaggagttctgggatgagtcg
atgctggagaagcccgaaggccgagaggtggtgtgccatgcgtctgcctgggacttttac
aaccgcaaggacttcaggatcaagcagtgcaccacagtcacgatggagcagctcttcacc
gtacaccatgagatggggcacatccagtattacctgcagtacaaggaccagcctgtgggc
taccgtcgtggagccaaccccggcttccacgaggctattggcgatgttttgtctctgtcc
gtttccacacccaaacatctgcataccattaatctgctggattctgtggtctctgacgaa
gaaactgatatcaactacctgttgaagatggctctggagaagatcgccttccttcccttt
ggctacctcatcgaccagtggaggtggggtgtgttcagtggacgcactcctccagagcgg
tacaactccgagtggtggtacctcaggacaaaatatcaaggcatctgccaacccaccgga
cgtacagaggaacactttgatcctggcgcaaaataccacatccctggaaacacgccatac
attaggtattttgtcagctttatcctgcagttccagtttcatgaaaaactatgccaagca
gccaaccacaccggtcctctgcacacatgcgacatctaccgctccgcagaagcaggcgct
attttgaagaaagttctccaggctggctcttctaaaccttggcctgttgtgctccaggag
gctattggcaccaacaagatggatgcgagctcgctgatgaaatactttgaccccatcatt
cagtggctgaaaaagcaaaatgtaaatgagaccttgggatggcctgacttcaactgggtc
ccacccgtccctgagggctaccctggagatattgacaagaatacagatgagctcgatgca
aagaagtttctggacgagtacaacagtacagctgagggggtgtggaacgcctacaccgag
gcctcctggaagtacaacactgacatcaatgaagccaataagcaggaaatgcttaagaaa
aacctggagatgtcagcccacaccttgaagtacggacagaaggcccgtcagtacgacact
actgacttccaggacccctcggtcaaacgcatcatcaaaaaactcagcgacatcgagcgg
gccgcactgcccacgacacagctggaagagtacaacactctcctgtccaacatggagacc
aagtacagtgtggctgaggtctgcagagataacgggacatgccaccctctggatccagat
ctccagaagatcatggcagagtccagggattatgatgaattattatttgcctggaaagga
tggagagatgctgctggaaaagtacttcgtcaggattacaagagatatgttgaactggcc
aacaaagcagccacactaaatggtcactctgacaatggggctttctggcgctccctgtat
gaaacccctacctttgagcaagacctggagagcctgtggaaggagctggaacctctctat
cagaacgtacatgcctatgttcgcagggctttgtacaaaaagtatggtcccaagtacatc
aaccttaagggacccattcctgctcacttgctgggcaacatgtgggcacagacgtggtct
ggcataatggatttggtcatgccctttccaagtgcaacacaagttgacgccacgccagct
atggtggcaaagaactggaacgccaccgtaatgttccaggagtcggacaggtttttcacc
tctctcgggttgaagccaatgccagaggagttctggaagaagtccatgctagtgaagccg
tctgacggacgccaggtggtgtgccatgcctcggcatgggacttctacaaccgaaaagac
ttcaggatcaaacagtgcactgttgtgactatggatgacctgatcacggtgcaccatgag
atgggccacgtccagtacttcctgcagtacaaagaccagcctgtgtccttccgtgatgga
gccaaccccggattccatgaggccatcggtgatgtactggccctttctgtgtccacgccc
aaacatttgcagagcatcggcctcttggacaaagttgaggccaacgtcgagagtgatatt
aacttcctgatgagcatggcgcttgacaagatcgccttcctaccttttggctacctgatg
gaccagtggagatggaaggtatttgatggacgcatcccacaggacgagtacaataaagag
tggtggaacctcagaatgaaataccagggactgtgtccacctgtagtccgcactgaggat
gacttcgaccccggtgcaaagttccacatccctgctaatgtgccttacgtcaggtacttt
gtcagcttcatcgtccaattccagttccacaaggctctgtgtgaggctgctaaccatgtt
gggcctctccatacctgcgatatctacaaatctacagacgctgggaagctgctgggtgac
gtgatgaagctgggcttcagtaagccctggcccgaggcgatgaccatgatcaccggccag
cccaaaatgagtgcccagccactcatgcagtatttccaacctctcattgactggcttgag
aaagagaacaacaagaacaacgatatccgcgggtggcctgagtacgactggaaaccttca
actacaggtgaagttaaagctaataaagtggacttcctgggtatgagtgtggacagctca
gctgccttagctggccagtgggtcctgttggtcattggcctggtcctcttgctcgccacc
atcctgttggcctacaagtacaggaagtcaagaaggcctgaaaagtccttatccacgatg
gagctcaagcaaaaggactaa

DBGET integrated database retrieval system