KEGG   Seriola dumerili (greater amberjack): 111221119
Entry
111221119         CDS       T05606                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04068  FoxO signaling pathway
sdu04110  Cell cycle
sdu04115  p53 signaling pathway
sdu04218  Cellular senescence
sdu04310  Wnt signaling pathway
sdu04340  Hedgehog signaling pathway
sdu04371  Apelin signaling pathway
sdu04510  Focal adhesion
sdu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111221119 (ccnd1)
   04340 Hedgehog signaling pathway
    111221119 (ccnd1)
   04371 Apelin signaling pathway
    111221119 (ccnd1)
   04068 FoxO signaling pathway
    111221119 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111221119 (ccnd1)
   04115 p53 signaling pathway
    111221119 (ccnd1)
   04218 Cellular senescence
    111221119 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111221119 (ccnd1)
   04530 Tight junction
    111221119 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111221119
NCBI-ProteinID: XP_022600177
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEETYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQLSSSTETKRVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactccatcaggagagcctaccaggacgtc
aacctgctcaacgaccgggtcctccacaccatgctgaaggcagaggagacctacctgccg
tcgcccaactacttcaagtgtgttcagaaggaaattgttcctaaaatgaggaaaatagtt
gctacctggatgttggaggtctgcgaggaacagaaatgtgaggaggaggtttttcccctg
gctatgaactatttggacagatttttatcagtggaggccaccaggaaaacacgactacag
ctgctgggagctacgtgcatgtttctagcatccaagatgaaggagactgtgcccttaacg
gcggagaaactctgcatctacacggacaactcggtccagcctggagaactcctgcaaatg
gagctgctggttctcaacaagctgaagtgggaccttgcttcagtcacacctcacgacttc
atcgagcacttcctgtccaagctgaagatctacccgtccaccaagcagatcctcaggaag
catgcccagacctttgtggcgctctgtgctacagatgttaacttcatcgccagtcctccg
tccatggtggcggcaggcagtgtggttgcagctgttcaaggtctctacctgaagagccaa
gacgcctccttgtcctcccaaaacctcaccaacttcctgtcgcaggtcattcgcagtgac
ccggactgcttgcggtcatgtcaggagcaaatcgagtctctgctggagtccagcctgcgg
caggctcagcagctcagcagcagcacagaaaccaaacgtgtggacgaggacgtggacctg
tcctgcacgccgacagacgtcagagacatcaacatctga

DBGET integrated database retrieval system