KEGG   Seriola dumerili (greater amberjack): 111221866Help
Entry
111221866         CDS       T05606                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00010  Glycolysis / Gluconeogenesis
sdu00051  Fructose and mannose metabolism
sdu00052  Galactose metabolism
sdu00500  Starch and sucrose metabolism
sdu00520  Amino sugar and nucleotide sugar metabolism
sdu00524  Neomycin, kanamycin and gentamicin biosynthesis
sdu01100  Metabolic pathways
sdu01200  Carbon metabolism
sdu04910  Insulin signaling pathway
Module
sdu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sdu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111221866 (hk1)
   00051 Fructose and mannose metabolism
    111221866 (hk1)
   00052 Galactose metabolism
    111221866 (hk1)
   00500 Starch and sucrose metabolism
    111221866 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    111221866 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    111221866 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111221866 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sdu04131]
    111221866 (hk1)
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     111221866 (hk1)
Membrane trafficking [BR:sdu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    111221866 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 111221866
NCBI-ProteinID: XP_022601176
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDIMQRFRRELSKGLGRDTNPTAA
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILHVRVSHEKKQTVQMESQIYDTPEDIIH
GGGTRLFDHVAECLGDFMEKHNIKDKKLPVGFTFSFPCQQTKLDEGYLITWTKRFKAGGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAREGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLTKAREILTRLG
VEPSTDDCIAVQHVCTIVSFRSANLIAATLAAILMRLKENKGVSRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLADQSRQIAETLSEFRLT
TEQLLEVKKRMRAEIQNGLSKSTQDCATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIEMIEGDEGRMCVNMEWGAFGDNGCLDD
IRTEYDRAVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTRRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSSCDDSIIVKEVCEAVSRRAAQICGAGMAA
VVDKIRENRGLDHLNITVGVDGTLYKLHPHFSGIMHQTVNELAPQCNVNFLLSEDGSGKG
AALITAVGCRLRQELNNK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcggcccagctactagcctattacttcactgaactcaaggatgaccaggttaaa
aagatcgataagtacctgtactccatgcgtttctctgatgagacgttactggacatcatg
cagcgctttcggagggaactgtccaaaggactgggtcgggacactaaccccactgctgct
ctaaagatgctaccaacgtttgtgcgatcaatcccagatggttcagagaaaggagacttc
attgcgttggatctgggaggcagtaacttcaggatcctccatgtcagagtgagccatgag
aagaaacagactgttcagatggagagtcaaatctacgacacgccagaggacataattcac
ggaggtggaacgaggctgttcgaccatgtggcagagtgtctcggggacttcatggaaaaa
cacaacatcaaagacaagaaactcccagttggttttaccttctccttcccctgccagcag
accaaactagatgagggctatctgataacatggacaaagcgtttcaaggctggtggagtg
gaggggatggatgttgtcaagctgctcaacaaagctattaagaaacgaggagactatgaa
gctgacatcatggctgtggtaaatgatacagttggaacgatgatgacctgtggtttcgat
gatcaacgctgtgaagtcggcatcatcatcggtactggcaccaatgcgtgctacatggag
gagctgcgtcacattgatctggtggagggagacgagggcaggatgtgtgtgaacactgag
tggggagcctttggagacgacggcagactggaagacatcaggacagagtttgacagagag
atagaccgaggctctctcaaccctggcaaacagctatttgagaagatggtcagtggtatg
tacatgggggagctggtgcgtctcattctggtgaaaatggccagagagggcctgctgttt
gagggaaggatcacccctgagctactcactaaaggaaagtttgagaccaagcacgtctca
gccatagagaagagtaaggaaggactgaccaaagccagagagattttaaccagactcggt
gtggagccctcgactgatgactgcatcgctgtgcagcatgtttgcaccattgtgtctttc
cgctctgccaacctgatagctgccaccctggctgccatcctaatgaggctaaaggagaac
aaaggtgtgtcacgactccgaaccaccgtaggcatcgatggctctctctacaagatgcac
ccacagtatgcccgtcgtcttcataagacagtccgtcgtttggtcccggactctgatgtt
cgattcctcctatcggagagtggcagtggaaagggcgctgccatggtaacagctgtggcc
tatagactcgctgaccaatcacgacaaatcgcagaaacactgtccgaattccgcctgaca
acggaacagctgctggaggtaaagaagcgaatgagggcagagatccaaaatggcctttcg
aagagcactcaggactgtgctactgtcaaaatgctgccaacctttgtacgaagcactcca
gatggcacagagaatggagatttcctggccttggatttaggaggaaccaacttcagagtt
ctgctggtcaagattcgttctggcaagaggagaacagtggagatgcacaacaagatctac
gccattcctctagaagtgatgcaaggcacaggagaggagttgtttgatcacattgtgcag
tgcatcagtgacttcctggattacatggggatgaagaacgctcgtcttcccctgggcttc
accttctcattcccctgccgacagaccagcctggatgctggcatcctggtgacatggaca
aaaggcttcaaggcgacagactgtgaaggagaagatgtggtgggactgctgagggaggcc
attaagaggagagaggaatttgacctggatgtagtggccgtagtcaacgatacagtggga
accatgatgacttgtgcctacgaagaacccacctgtgagattggactgatcgctggcact
ggcagtaatgcatgttacatggaggagatgaggaacattgagatgattgagggagatgag
ggacggatgtgtgtcaacatggagtggggggcttttggagacaacggatgccttgacgac
atcaggacagagtacgaccgcgctgtggatgacttctcgcttaatccaggcaaacaaaga
tatgagaaaatgtgcagcggcatgtaccttggtgaaattgtgcgaaacatcctcatagac
atgaccaggagaggattcctgttcagagggcagatttctgagacactgaagactagaggc
atctttgaaacaaagttcctctcacagatagagagtgacagattggctttgctgcaggtc
agatccatcctgcaacacttaggactggacagcagctgtgatgatagtatcatagtaaaa
gaggtatgtgaagcagtgtcacgtcgtgcagctcagatttgtggggcaggaatggcggct
gtggtcgataagatcagagagaaccgtggactggaccatctcaacatcactgtaggggtg
gatgggacactctacaaactacatccacatttctcggggatcatgcaccaaacagttaat
gaactggctcctcagtgtaatgtcaacttcttgctgtcagaggatggcagtgggaaagga
gctgcactcatcacagccgtgggctgccggctaagacaagagctgaacaataaatag

DBGET integrated database retrieval system