KEGG   Seriola dumerili (greater amberjack): 111222103
Entry
111222103         CDS       T05606                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04012  ErbB signaling pathway
sdu04068  FoxO signaling pathway
sdu04110  Cell cycle
sdu04115  p53 signaling pathway
sdu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111222103
   04068 FoxO signaling pathway
    111222103
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111222103
   04115 p53 signaling pathway
    111222103
   04218 Cellular senescence
    111222103
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111222103
NCBI-ProteinID: XP_022601394
LinkDB
Position
Unknown
AA seq 170 aa
MCRTMDANKRILSTLGNGPARRNLFGPVDRELLQVEYQAALQKDLEEASQRWGYDFISDK
PLENSDFQWEGIPATKVPLLYRSCLLGLGQTERLRPAEAKIRSKGGRVEPPQSEKENIPG
TPERYALNLENLENTPEKRENTGVKRKQTNITDFYQAKRRVVGMPRKSGE
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtgtagaacaatggatgctaacaagcggatcctgagcaccctggggaatggccctgct
cgacgaaacctgtttggcccagtcgaccgagagctactgcaggtggagtaccaagctgcc
ctgcagaaagacctggaggaggcttcacagcgctggggctacgacttcatctcggacaag
ccactggagaacagcgatttccagtgggagggaatcccagctaccaaggtgccgctgctc
tacagatcctgtttgcttggtctgggacagacagaacgtctgaggccagcagaggcaaaa
ataaggtccaagggaggaagggtggagccaccacagagtgagaaggagaacatcccaggc
acaccggagagatatgcactcaacctggagaacctggagaatacaccagagaaaagagag
aatacaggagtgaagaggaaacagacaaacattacagatttctatcaggctaaaagaaga
gtagttgggatgccgcgcaaatccggcgagtga

DBGET integrated database retrieval system