KEGG   Seriola dumerili (greater amberjack): 111222528
Entry
111222528         CDS       T05606                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111222528 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    111222528 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sdu04052]
    111222528 (kitlg)
Cytokines and growth factors [BR:sdu04052]
 Growth factors
  Growth factors (RTK binding)
   111222528 (kitlg)
SSDB
Motif
Pfam: SCF DASH_Dad4
Other DBs
NCBI-GeneID: 111222528
NCBI-ProteinID: XP_022602012
LinkDB
Position
Unknown
AA seq 266 aa
MKKSKIWIRLCVHLLLFITLGVHSSKFDVNPVTDDISRLSILRQNIPKDYKIPVHYIPKE
EGGMCWVKLNVFYLEESLQDLAHKFGNISSNRKDISIFIQMLQELRLNMGSVEPIMYDFE
CHYREERWQTARYFDFVKDFLIAAQNREDSDDCDPPPCPTTPYTVTEEYLKASPTSSSKG
SDCPTGCNPLPNKEARFLPEVVERSLLSLLFIPLLALVFLLVWKVRSRRNEEDTQQNPEA
GEHFTGTEWTAPPVDEPSEKNKLNVI
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacgcctctgtgtccatttactgctgttcatcacgctt
ggggtacattcaagtaaatttgacgtcaacccagtgacagatgacatctctagactctct
attttgagacaaaatattcctaaagattacaaaattcctgtacattacattccaaaagaa
gagggtgggatgtgttgggtaaaattaaacgtcttctacttggaggagagtttacaagat
ttagcgcataagtttggaaacatttcatccaacagaaaagatattagcatattcatccaa
atgctccaagaactgcggctcaacatggggtctgtggagccgatcatgtacgattttgag
tgccactacagggaagagaggtggcagacggcgcgatactttgactttgtcaaagacttc
cttatagctgcacagaatagagaagattcagatgactgtgatcctcctccctgtcccacc
acaccatacacagtaacagaagaatatttaaaagcatcacccacgtccagcagtaaaggc
tcagactgtccgacgggctgcaatccactcccaaataaagaagcaagattcctgcccgag
gtggtggagcgaagccttctctccttactcttcattccactcctagccctcgtattcctg
cttgtgtggaaggtccggtcacggaggaacgaggaggatactcaacagaatcctgaagca
ggtgaacatttcacaggaacagaatggactgcacctccagtagatgaaccatcagaaaaa
aacaagttgaacgtcatttaa

DBGET integrated database retrieval system