KEGG   Seriola dumerili (greater amberjack): 111222838
Entry
111222838         CDS       T05606                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
sdu  Seriola dumerili (greater amberjack)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2
Other DBs
NCBI-GeneID: 111222838
NCBI-ProteinID: XP_022602415
LinkDB
Position
Unknown
AA seq 358 aa
MSKCELIELQDLSVNDPIELAAPAARTVQPPVNPGLPCTFHVVRLVGDSVSIEAPGCQTG
EAAGGHDFQPYGYTHLTWCDLCGEFIWGLYKQSLRCTNCSYTCHYRCRPFIQLDCSTDGS
LLTDRADFSDDSIETDTNVDEQIDLGKQQLSVAEIQQKVKEYNAQINSNLYMMVNKDGFY
TGFIKVHFRLVRPISLPPPQSLCSTQEEDQQGRRMKRRTSFYLPKDTAKHLHISSQTRVR
EVIEALLNKFTVVDNPAKFALFERTERQSQVYMRKLSDDQCPLYLRLCAGPSEKVLSLVL
KENETGDVNWDAFSFPELCNFLRILQREEEEHVRQIVKRYALAKEKMKHAMARITTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgatcgaactgcaggacctcagtgtaaatgatcccattgaactg
gctgctcctgcagcccgcactgtccagccacctgtgaacccaggtctgccctgcaccttc
catgtcgttcgtctggttggagacagtgtcagcatcgaggcccctgggtgtcagacagga
gaggctgcaggtggtcatgacttccagccctatggttacactcatcttacctggtgtgac
ctgtgtggagaattcatctggggtctttataagcagagtttacgctgcaccaactgcagt
tacacttgtcactaccgctgccgaccattcatccagctggactgcagcacagatggaagt
ttgttaacagaccgggcagatttctctgacgactccatcgagacagacacaaatgtggat
gaacagatcgatttgggtaaacagcagttaagtgtcgctgagattcaacagaaggttaag
gagtataatgctcagatcaacagcaatctctacatgatggttaataaagacgggttctac
actggttttatcaaggtccacttccggttagttcgaccgatttccctccctcctcctcag
agcttgtgctcgacacaagaggaagatcagcagggcagacggatgaaacggcggacttct
ttctacctccctaaagatactgcaaaacacctgcatataagctctcaaacacgggtacgg
gaagtcatcgaggcgttgctcaacaagttcactgtggtggacaacccagccaagtttgcc
ctgttcgaacgcactgagagacaaagtcaagtgtacatgcgtaaactgtctgatgatcaa
tgtccactctacttacgcttgtgtgctggccccagtgaaaaagtcctgagtctggttttg
aaagaaaatgaaacaggggatgtcaattgggatgcatttagctttcctgagttgtgcaac
tttctgcgaatcctgcagcgtgaggaggaagagcatgtccggcagattgtgaagcgctat
gctcttgctaaggaaaagatgaagcatgccatggcaaggattactacacctggttga

DBGET integrated database retrieval system