KEGG   Seriola dumerili (greater amberjack): 111222913
Entry
111222913         CDS       T05606                                 

Definition
(RefSeq) cell wall integrity and stress response component 1-like
  KO
K08774  transforming growth factor, alpha
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111222913
   04012 ErbB signaling pathway
    111222913
SSDB
Motif
Pfam: EGF Laminin_EGF
Other DBs
NCBI-GeneID: 111222913
NCBI-ProteinID: XP_022602542
LinkDB
Position
Unknown
AA seq 248 aa
MTRIFWDTIFLISGSLFTFGAGPSNSTIIEARISIDTNSTAAPNTSTSSSATTSSATTTT
DIPTVKNSLFTFETGQTNSTIIDAGISIATNSSAAPNTSTSSSATVSSRSTTTTTIATTT
TSIPPVKKFVAAAVRSHFDDCPDSHRHFCFHGTCRFLILEETPACVCHPGFVGMRCEHAD
LLAVVATNHRQQTVATVLVLCVIGCVLIMVLCTLLHCWWRQDCRRRSHAHHYVPEKHIAS
CYPSESVV
NT seq 747 nt   +upstreamnt  +downstreamnt
atgacgcggattttctgggatacaatttttcttataagcggttccctctttacatttgga
gcagggccgagcaattcaacaattattgaagctcgtatttccattgatacaaactccacg
gctgctccaaatacctccacaagcagctctgcaacaaccagcagcgcgacgactacaact
gacatccctacggttaaaaattccctctttacatttgaaacagggcagaccaattcaaca
attattgacgctggcatttccatcgctacaaattcatctgcagctccaaacacctcgaca
agcagctctgcaacagtcagcagcagaagtaccactaccacaactattgcaactactacc
actagcatacccccagttaaaaagttcgtggctgcagctgttcggtctcatttcgacgac
tgtccagactcccaccgccatttctgcttccacggcacctgccgcttcctgatattagag
gagacgcctgcatgtgtgtgtcatccaggcttcgtcgggatgaggtgtgagcatgcagac
ctgctcgctgtagtagcaactaatcacagacaacagaccgttgccacagtgctggtgttg
tgtgttattgggtgtgttctgatcatggtgttgtgcacacttttacattgctggtggagg
caggactgtcgcaggcggagtcacgcacatcactacgtcccggagaagcacatagcatct
tgctatccatctgagagcgtggtttga

DBGET integrated database retrieval system