KEGG   Seriola dumerili (greater amberjack): 111222918
Entry
111222918         CDS       T05606                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
sdu  Seriola dumerili (greater amberjack)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 111222918
NCBI-ProteinID: XP_022602546
LinkDB
Position
Unknown
AA seq 365 aa
MSCGEFIELRDLRNNREQIELTSTHSPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
STQDPQLKEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
QLDCSLDQGSVSDQTCVVEHTIETDTNVDEQIDCGKQELTTADIQQKVKEYNGQINSNLF
MNMNKDGSYTGFIKVQFKLVRPVSVPHPKKGGQDAGGRKASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDAERPLRLRLCAGPS
EKVLSFVIKENETGEVNWHAFSMPELKNFLRILQREEEEHVKQIVQRYALARTKMQEALA
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttgtggggagttcattgagctacgtgacctgcgcaacaacagagaacagatagag
ctgacaagcacacattcaccctgctcccctcctcgactggagagaaccaacgccctgagg
atcagcccggggaaggtcccagacctgctgagccgggtgggcatcatcagagtcctgagc
agcacccaggacccccagctcaaagaggagaagggagagggacacaacttccaaccctgc
agccacgctcagcccacgtggtgtgacctgtgtggagacttcatctggggcctttacaag
cagagcctgcggtgtgtcaattgtagattcacatgccactaccgctgtcgagccctgatc
cagttggactgcagcttggaccaaggctctgtgtccgaccaaacatgtgttgtggagcac
accatagaaacggacacaaatgtggatgaacaaatcgactgtgggaagcaggagttgaca
actgcagatatccagcagaaggtcaaggaatacaacggtcagatcaacagcaatctgttc
atgaacatgaacaaggatggttcctacactggcttcataaaggtgcagtttaagttggtg
cgacctgtgtcggttccacatccaaagaaagggggtcaagatgctggagggaggaaggct
agcggagtgaagcgtcgcacctctttctacctgccaaaggatgcatccaagcacctgcac
ataagctcccgcacctctgcccgtgaggtcattgaggctttactgaaaaagtttactgtg
gtggacaatcctggcaaatttgctctgtttgagcgtagcgagcgtcatgaccaggtttat
gttcgcaagctgtctgatgccgaacgtcccctccgtctgcgtctgtgtgctgggccgagt
gagaaagtcctcagttttgtgatcaaagaaaacgaaactggagaggtcaattggcatgcc
ttctctatgcctgagttaaagaacttcctgcgtattctgcagcgtgaagaagaggaacac
gtcaagcagatagtgcagcgatacgctctggcccgcactaagatgcaggaggcgctggct
ggctccacccctggttga

DBGET integrated database retrieval system