KEGG   Seriola dumerili (greater amberjack): 111223608
Entry
111223608         CDS       T05606                                 

Definition
(RefSeq) lysophosphatidic acid receptor 6-like
  KO
K04273  lysophosphatidic acid receptor 6
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111223608
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sdu04030]
    111223608
G protein-coupled receptors [BR:sdu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111223608
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 111223608
NCBI-ProteinID: XP_022603541
LinkDB
Position
Unknown
AA seq 315 aa
MSTNISSSCLNSSDYTSNIFTVCTYSFICIVGLIFNLTALVFFFRCNKTRSQTIVYMSNL
TIADSLLILTLPMRIYYYLGYRGLPQWLCDSLGLVLKANMYGSIFLLTCICFDRCMAVSF
PMSVRVKEGRRKAPLVCFGIWMLTFGASVPIYLFKRRDVHDSFTDCFNNLPVYAIQPLVV
YPTLILGFGIPLVIMLVCSWGLVRAVRQSPVAQTNLVDSAKIQRMVASSLFIFIFSFLPY
HATLGLLSLYRENIPCSMLTAYHYSVMVACLNTVLDPVAYYFTTETFTKNVGIDVVRMFP
LNSHSSEVRYRANNS
NT seq 948 nt   +upstreamnt  +downstreamnt
atgtccaccaacatctcgtcttcctgtctcaacagttcagactacaccagcaacatcttc
actgtgtgcacctactccttcatctgcatcgtgggtctgatctttaacctcacagctctg
gtcttttttttcagatgcaacaaaaccagatcacaaaccattgtctacatgagcaatctc
accatagcggacagtctgctcattctcacattgcccatgaggatctactactatctgggt
tatcgtggtcttcctcagtggctgtgcgacagcctcggtctggtcctgaaggccaacatg
tacgggagcatcttcctcctcacttgtatttgctttgaccgttgcatggccgtcagcttc
cccatgtcagtgcgtgtgaaggaggggaggaggaaagcgccgctggtttgtttcggaata
tggatgctcaccttcggggccagcgtgcccatctacctcttcaagcgcagagatgttcac
gattctttcacagactgttttaataacttgccggtctatgctattcagcctctggtggtt
tatcccacgctgatcttggggtttgggatcccgttagtgatcatgctggtctgctcttgg
ggtttggtccgtgctgtccgacagagccccgtggcccagaccaacctggtggacagcgca
aagatccagaggatggttgcttccagcctcttcatcttcatattcagtttcctcccatac
cacgccaccctgggcctcctctcactgtacagagagaacataccatgctccatgctgact
gcataccactacagcgtgatggtggcatgtctcaacacagtgctagatcctgttgcatac
tatttcaccacagaaaccttcacaaagaacgtgggcatcgatgtggtgaggatgtttcct
ttgaacagtcatagctctgaagtcaggtacagagctaacaacagctaa

DBGET integrated database retrieval system