KEGG   Seriola dumerili (greater amberjack): 111224579
Entry
111224579         CDS       T05606                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04020  Calcium signaling pathway
sdu04260  Cardiac muscle contraction
sdu04261  Adrenergic signaling in cardiomyocytes
sdu04270  Vascular smooth muscle contraction
sdu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111224579 (cacna1c)
   04020 Calcium signaling pathway
    111224579 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111224579 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111224579 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    111224579 (cacna1c)
   04270 Vascular smooth muscle contraction
    111224579 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sdu04040]
    111224579 (cacna1c)
Ion channels [BR:sdu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111224579 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 111224579
NCBI-ProteinID: XP_022604843
LinkDB
Position
Unknown
AA seq 2309 aa
MLRGLFQRKPKHERLEEEPEVRFKGSLVSETDLGYTYVRPGGSDYSPPPPLPRPPPTGLT
NEHSGGGSHGDHGGGGGGVNHGVGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAAA
GGGAGLGSGGGGPISTASSTQRKRQHYSSKPKKQTTTTATRPPRALLCLTLKNPIRRACI
SIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKV
IAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRA
FRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTC
VYEHIGTNAEEKPAPCAPDGAYGRHCKQNGTECKMGWEGPNDGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGMDDDKPRNLSMPASENESVNTDNA
PGGDVEGETCCTRLANRISKSKFSRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTL
TIASEHHQQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG
PSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARL
ASPEKRHDNEKPPLEEEKKEKIELKSITSDGETNTATKINMDDYCGDETEEKNPYPANDY
IGDDDDDEPEMPVGPRPRPLSDIQLKEKAIPMPEARAFFIFSHTNKFRVLCHKIVNHNIF
TNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKG
SFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCV
FVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTEAECRGSYIMYKDGDVG
KPVRASRLWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVI
SIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRY
IPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTSNFNDAMNILNMLFTGLF
TVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSPSSSS
SSSSHPPVVRPMNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYV
ALLIVMLFFIYAVIGMQMFGKIALQDNTQINRNNNFQTFPQAVLLLFRCATGEAWQEIML
ACSPNRPCEKGSTNENSTTNEDCGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLV
SMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKKIWKRTSMKLLDQV
VPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSLQAGLRTLHDIGPE
IRRAISGDLTVEEELDKGLKEPVSAASEDDIFRRTGGLFGNHVNYYNQSDGRGSFPQSFT
TQRPLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSGSNANINNANNTGMAGVATQGI
SRFPSPSISTVDGHTGQPLTPILLPRSAWCFPPKRTCFYDNLMRSDSSDSRLPIIRRGEG
STEETYDESYGEDREYHEDDHSLSSDMLVYHDDTCKQLTPMEEGEEVEDRRGGGWQSPRR
VFLCPTSLGRRSSFHLECLRRQSRPDVSQKTAVPLHLVHHQALAVAGLSPLLRRSHSPTL
FSRLCSTPPASPTAHGSDASYQRVPSLRLEGSNSHEKLNTSLPSVNCGPWYSDSNGNSRG
PSPSPTPSVSVSNQRAPRPVSLTVPSLLGKDSSTLCHGSAGSLVEAVLISEGLGHFAQDP
SFIEATKAELADACDMTIEEMEHAANNILNGNTTTNATSSTSSTSQHSPNGNLLPFHTAA
AATHRDRVVSLSPSEGGGEAAGSRGSIHGPSSVEERQELLAGGRGREEEEEEAEEREEGH
HRSSVVIGAARQRNSGLLEDEDMECVTSL
NT seq 6930 nt   +upstreamnt  +downstreamnt
atgctgagaggcctgtttcagaggaaacctaaacatgagagactggaggaggaacctgag
gtcagatttaaaggctcgctggtgtcagagacagacctgggatacacatacgtccggcct
ggaggctccgactattctccccctccgcccctgcctcggcctcctcccaccggcctgaca
aacgagcacagtggtggtggtagccatggtgaccatggtggaggagggggcggggtcaac
cacggggtcggcgtggtgggcctggctccggagcacatccccacaccgggggcggccctg
agctggcaggcggccatcgacgctgcgcggcaggcaaagatgatgggcaacgccgcagca
ggtggaggggcagggcttgggtcgggagggggcgggcccatctccacggccagctccacg
caaaggaaaagacaacactatagctctaagcccaagaaacagacaacgacgacagccaca
aggccgccacgggccctactctgtctcacgctcaagaaccccatccgcagggcctgcatc
agcatcgtagagtggaaaccatttgagatcatcatcctgatgaccatattcgccaactgt
gtggccttagccgtctacatccccttccccgaggatgactcaaacgccaccaactccaac
ctggagcgtgtggagtatctgttcctcatcattttcacggtggaggcgttcctgaaagta
atagcctatggcctgctcttccaccccaacgcctacctgaggaacggctggaatctgctc
gacttcatcatcgtagtcgtagggttattcagcgcgatcttggagcaggccacaaagggg
gatggggccactcctattggagggaaggcagcaggcttcgatgtcaaggctctgagggca
ttcagagtactcagacccctcagactggtctccggagtaccaagtttacaggtagtgttg
aactccataatcaaagccatggttcctctgctccacatcgccctgctggtcctcttcgtc
atcatcatctatgccatcatcggcctggagctcttcatgggcaagatgcacaagacctgc
gtttacgagcatataggcaccaatgcagaggaaaagccggcaccgtgcgcacctgacgga
gcttatggtcgacactgtaaacagaatggaacagagtgtaaaatgggatgggagggtccc
aatgacggcatcaccaactttgacaactttgcctttgccatgttaacggttttccagtgt
ataaccatggagggctggacggacgtgctatactggatgcaggatgctatgggctatgag
ctgccatgggtctattttgtctctctcgtcatcttcggctcctttttcgttctcaatctc
gttctgggggtgttgagcggagagttttccaaggagagggagaaggccaaggcgcgtggt
gacttccagaaactcagagaaaaacagcaactagaggaggacctcaagggctatttagac
tggatcactcaggctgaggacattgacccagagaatgaagaggagggcatggacgatgac
aaacccagaaacctgagcatgccagccagtgagaatgaatcagtcaacacagacaatgcc
cccgggggagatgtggagggggagacctgctgtacccggctagcaaataggatctccaaa
tccaagttcagtcgctactcgcgaaggtggaacagactctgcagaaggaagtgccgggcg
gcggtcaaatcgcaggttttctattggttggtcatcttcctggttttcctcaacactctg
accatcgcctctgaacatcaccagcagcctcagtggttaactgatgtacaagacatagct
aataaggtgttgctagcactcttcactggtgagatgctgttgaagatgtacagtttgggc
ctacaggcgtactttgtttcgctctttaaccgcttcgacagcttcgtagtatgtggagga
attctggagaccattctggttgaaaccaagatcatgtctcctctcggcatctctgtgtta
cgctgtgtacgcttgctacgaatcttcaaaataaccagatactggaactcactgtccaac
ctggtggcctccctgctaaactccgttcgctccatcgcttccctgttgctcctgctcttc
ctcttcatcatcatcttctccctgctcggcatgcagctctttgggggaaaattcaacttc
gacgagacccgacgcagcaccttcgacaactttccccagtctctgctgactgtgtttcag
atcctaacaggagaggactggaactctgtgatgtatgatggcatcatggcgtacggtgga
ccctcctttcctggcatgctggtctgcatctacttcatcatcctcttcatctgcggaaac
tatatcctactgaatgtcttcttggccatcgctgtagacaatctggccgatgctgagagc
ctgacatctgcccagaaagaagaggaagaggagaaagagaggaaaaaactggccaggctt
gccagtccagagaagcgtcatgacaacgagaagccgcctctggaggaggagaagaaggag
aaaatagagctgaagtccatcacttctgatggagagaccaacactgctactaagatcaac
atggatgactactgtggagatgagactgaagagaagaatccatatcctgcaaatgattac
ataggagacgatgatgatgatgagccagagatgccagtgggcccgaggccgcggccactc
tccgacattcagctgaaggagaaagccattcccatgcctgaggcccgtgctttcttcatc
ttcagccacaccaacaaattcagggttctttgccataagatcgtcaaccacaacatcttc
accaacctcatcctcttcttcatcctgctcagcagcatcagtcttgcagcagaggaccca
gtcaagaatgactccttcagaaaccagattctgggctatgcagatcatgtcttcactgga
ctgttcactatagagatcatccttaagatgacagcctatggagccttcctccacaaaggt
tcattctgtagaaactatttcaacatcctggacctggtggtggtcagtgtgtccctcatc
tcctctggaatacagtccagtgcaattaatgtggtgaagatcctgagagttctgagagtg
ctcaggccactaagagccatcaacagagctaagggactaaagcatgtagtgcagtgcgtg
tttgtggccatcaggaccatcggcaacatcgtcatcgtcaccacgttgctccagttcatg
ttcgcctgtattggagtacaactctttaagggcaagttcttctactgtaccgacagctct
aaacagactgaggcagagtgcaggggttcctacatcatgtataaagacggtgacgtgggg
aagcctgtcagagcctcgagactgtgggagaacagtgactttaactttgatgatgtcctg
caaggcatgatggctctgttcgctgtgtctacctttgaggggtggccagggttactgtac
cgggccatagactctcacgctgaggacgtcgggcccatctacaactaccgtgtggttatc
tccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaacatcttcgtc
ggtttcgtcattgtcacattccaggagcaaggagagcaagaatataagaactgtgagctg
gacaagaaccagcgtcagtgtgtggagtatgccttgaaggcccgtccattgcgccgctac
atccctaagaacccctaccagtacaaggtgtggtatgtggtcaactccacctactttgag
tacctgatgttcacactcatccttctcaacaccatctgtctggccatgcagcatcatgga
cagacctcaaatttcaatgatgccatgaacatcctcaacatgctcttcactggacttttc
actgtggagatgatccttaaactgattgccttcaaaccaagggggtactttagtgatccc
tggaatgtgtttgatttcctcatcgtaattggcagcataatagacgtcattctcagtgag
atcaacccagctgactcctcctcgtcctcgtcctcctcctcttcgccctcctcctcctcc
tcttcctcctctcacccccctgtggtaaggccaatgaactctgaagagaacgccaggatc
tccatcaccttcttccggctgttccgcgtgatgaggctggtgaagctgctgtctcgcggg
gaagggattcggaccctgctgtggaccttcatcaaatccttccaagctctgccctacgta
gctctgcttatagtgatgctattcttcatatacgctgtcatcggcatgcagatgtttggt
aagatagcgctgcaggataacacgcagatcaacaggaacaacaatttccagacgttccct
caggctgtgctgctgctcttcagatgtgcaacaggcgaggcgtggcaggagatcatgctg
gcgtgctcgcccaatcggccgtgtgagaagggctcaaccaacgagaacagcacgaccaat
gaagactgtggcagccagtttgccatcatttactttgtcagcttctacatgctctgtgcc
ttcctgatcatcaacctgtttgtggctgtcatcatggacaactttgactacctgacacgt
gactggtcgatcctggggccgcatcatctggacgaattcaagaggatctgggctgaatat
gacccagaagctaaggggaggataaagcaccttgatgtggtgactctgctccggagaatc
cagcctccgctcggctttggaaagctttgtccccacagggtggcctgcaaacgtctggtg
tcaatgaacatgcctctgaacagcgatggaacagtgatgttcaacgccacactgtttgcc
ctggtcagaaccgcactcaggattaagacagaaggtaacctggaacaggccaatgaggag
ctgagggcaatagtgaagaagatctggaagagaaccagcatgaagctcttggatcaagta
gtgccccctgctggtgatgatgaggtaacagtcgggaagttctacgctaccttcctcatc
caggaatatttccgcaagtttaagaagaggaaagaacaagggctggtagccaaggtgccc
cccaaaactgccctctctctgcaggcgggcctgcggacgttgcatgatattggaccagag
attcggagggccatctctggagacctgacagtggaggaggagctggataaaggcctgaag
gagcccgtgtcggctgcatccgaggacgatatcttcaggcgtacgggtgggttattcggc
aaccatgtcaactactacaaccagagtgatggccgcgggtccttcccacagtccttcact
acccagcgtcccttgcatatcagccagaagggctcaccttgcgaaggcgaaagcccgtcc
cacgagaagctcatggactcgaccactttcaccccttcctcttactcctcatcaggctcc
aacgccaacataaacaatgccaacaacaccggcatggctggggtggcaacccagggcatc
agccgattcccaagcccgtctataagcactgtggatgggcacacaggacagccactcacc
cccatcctgctgccaagatctgcgtggtgctttcctccaaagaggacgtgtttttatgac
aacctcatgcgctcggactcaagtgacagccgtctgccaatcatacgaagaggggagggg
tcaacggaggagacttacgatgagagctatggcgaggacagggagtaccatgaggatgac
cactcgctctcctctgacatgctggtgtatcacgatgacacgtgtaagcagttgactccc
atggaggaaggagaggaggtagaggacagaagaggaggaggatggcagtctcccaggaga
gtcttcctctgccccacttctctggggcggagatcgtccttccatctggagtgtctcagg
agacagtcaaggccagacgtgtcccagaagacggctgtacccttgcacctagtacatcat
caggcgctggcagtggcagggttgagtcctctgctaagaaggagtcactcacctaccctc
ttcagccggctgtgctctacacctccagccagtcccacagctcatggcagtgatgcctcc
taccagcgagtgccctctctgaggttagagggctccaactcccatgaaaagctcaatacc
agcctgccctctgtcaactgtgggccctggtacagtgacagtaatgggaacagccggggg
cctagtcctagtcccacccccagcgtgtcagtgtccaatcaaagagcaccacggccagtg
tcgctcacagtaccctcactactgggaaaagactccagcacgctgtgtcacggcagtgca
ggcagtctggtggaggcggtgctaatatcagagggtttgggtcatttcgctcaggaccca
tcattcatcgaggcgaccaaagccgagttagctgacgcctgtgacatgaccatcgaggag
atggaacacgccgccaacaacattctcaacggcaacaccaccacaaacgccacatccagc
acctcctccacctcccagcacagccccaacggcaacctcctccccttccacacagcagca
gcagcaacgcacagggaccgagtggtcagcttgagtcccagcgagggcgggggagaggcc
gcaggaagcagaggctccatccacgggccatcctctgtggaggagcggcaggagctgcta
gcagggggcagaggacgagaagaggaggaggaagaggcggaagaaagggaggaggggcac
cacagaagctcagttgtgattggagcagcgcggcagaggaacagcgggctgttggaggac
gaggacatggagtgtgtgacgagtttgtag

DBGET integrated database retrieval system