KEGG   Seriola dumerili (greater amberjack): 111224759
Entry
111224759         CDS       T05606                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04012  ErbB signaling pathway
sdu04068  FoxO signaling pathway
sdu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111224759
   04068 FoxO signaling pathway
    111224759
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111224759
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111224759
NCBI-ProteinID: XP_022605108
LinkDB
Position
Unknown
AA seq 190 aa
MCNKMSDVRLSNASPTLERGVDARQQDNLRPRVSRNLFGRPNPEEIQRNLDAVVQEEVQA
FRERYNFDPETDRPLSPRNYEWQEDSDPPEFYLRPPHGSQRPQRDVDLSGDNQQQDAEER
SERRSTRQPDRHGSKKRRRGALGPCSGECQSKRLHSDEDDDEDQSNGTGSQAVKAAEERP
SRPESSAEVQ
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaatgcgagcccgacattggagaggggg
gtggatgcgcggcagcaagacaacctcagacctcgggttagcagaaatcttttcggccga
cctaacccagaggagatacagaggaatttggatgctgtagtgcaggaagaagtgcaggct
tttagggagaggtacaatttcgacccggagaccgacagaccgctgagtccgcgtaactat
gagtggcaggaggacagcgacccaccggagttttatctcagaccgcctcacgggagccag
cggccccagcgagatgtggacttgtccggcgataaccagcagcaggacgccgaggagagg
agtgaacggcggtcgactcgccaaccagacagacacggttcaaagaaaagacgtcgagga
gctttaggtccctgctccggcgagtgtcaaagtaaaaggttgcattccgacgaagatgat
gatgaagaccagtcgaacggtacaggaagtcaggcggttaaagccgcggaggagagaccc
agcaggccggagagcagcgcggaggtccagtga

DBGET integrated database retrieval system