KEGG   Seriola dumerili (greater amberjack): 111225343Help
Entry
111225343         CDS       T05606                                 

Definition
(RefSeq) serine protease HTRA2, mitochondrial-like
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111225343
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sdu01002]
    111225343
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sdu03110]
    111225343
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     111225343
Peptidases and inhibitors [BR:sdu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111225343
Chaperones and folding catalysts [BR:sdu03110]
 Other chaperones and cochaperones
  DegP / HtrA
   111225343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 PDZ Peptidase_S46 Tricorn_PDZ HAS-barrel DUF31
Motif
Other DBs
NCBI-GeneID: 111225343
NCBI-ProteinID: XP_022605872
LinkDB All DBs
Position
Unknown
AA seq 444 aa AA seqDB search
MAAAAVNRCFLSALRTHSRCQSRGLNSLAERTVSWVSSVVMCKHGAAEGDTSLDRRAPAW
DRRSGRNNNSRSPLLRTVSVGLGLCGAALLDSQRDKKENDRRVSVVGRFLEHILPLAQCA
SPFKPDSPRYKYNFIADVVEKSTPAVVYIEIVGRHPFSGREVPVSNGSGFIISSDGLIVT
NAHVVANKRGVRVKLTNGDMYHATVQDVDQVADIATIKITANNPLPTLTLGRSSDVRQGE
FVVAMGSPFALRNTITSGIVSSVQRGSKELGLSNSNMEYIQTDATIDFGNSGGPLINLDG
EVIGINTMKVTAGISFAIPSDHLRAFLDRSAKKKSSWFRESETKRRYIGVMMLTLTPSII
AELKLRDPSFPDVTHGILIHRVIMGSPANRAGMLQGDVVVEINGVKVNTSEEIYQAVRSS
DKITMVVQRGNELLQLQMTPEYTE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagctgctgtcaatcggtgttttctgtcagcactaaggacacacagtcggtgt
caaagccgcggacttaactctctggcggagaggacagtcagctgggtgtcctctgttgtt
atgtgtaagcacggggcagcggagggggacacaagcctggacaggagagctcctgcttgg
gacaggagaagtggtcgtaacaacaacagcaggtctcctctgctcaggacagtatcggtg
ggtctgggtctgtgtggcgcagcgctactggatagccaaagagacaaaaaagaaaacgac
agacgagtctctgtggtcggacggtttcttgaacacatcctgccattagctcagtgtgct
tccccttttaaacctgacagcccccgatataaatacaactttattgcagatgtggtggag
aagtccaccccagctgtcgtgtacattgaaatcgtgggcagacacccattttcaggaaga
gaagtcccagtgtccaatggctctggtttcattatcagcagtgatggtctcattgtcacc
aatgcacatgttgtggccaacaagagaggtgtccgtgtgaagctcaccaatggagacatg
taccatgccactgtgcaggatgttgatcaagtggcagacattgccaccatcaagatcact
gcaaacaatcctttacccacgctgaccctaggtcggtcgtctgacgtccgacaaggggag
tttgtggtcgccatgggaagcccctttgctttgcgcaatacgatcacgtcagggatcgtc
agctcagtacagagaggcagtaaggagctgggcctgtccaactccaacatggagtacata
cagacagatgcaaccattgattttggaaattctggaggtcccctaattaacttggatggt
gaagtcattggtataaacaccatgaaggtcactgcagggatctcctttgctattccatct
gatcacctgagagcctttcttgatcgatcagcaaaaaaaaagagttcctggtttcgtgag
tcagagacaaagcggcgatacatcggcgtaatgatgctgacactgacaccaagcatcatt
gcggagttgaagttaagagacccatccttcccagatgtgacacatggcatcctgattcac
agagtcatcatgggctccccggccaacagagctggcatgctgcagggagacgtcgtggtg
gagataaatggggtgaaggtgaacacttcagaggagatctaccaggctgttcgcagcagc
gacaaaatcaccatggtggtgcagagagggaacgagttgctacaactgcaaatgactcct
gagtacacagagtga

DBGET integrated database retrieval system