KEGG   Seriola dumerili (greater amberjack): 111225351Help
Entry
111225351         CDS       T05606                                 

Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A-like isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00270  Cysteine and methionine metabolism
sdu01100  Metabolic pathways
Module
sdu_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    111225351
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sdu03032]
    111225351
   03036 Chromosome and associated proteins [BR:sdu03036]
    111225351
Enzymes [BR:sdu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     111225351
DNA replication proteins [BR:sdu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    111225351
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    111225351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP Ndc1_Nup
Motif
Other DBs
NCBI-GeneID: 111225351
NCBI-ProteinID: XP_022605884
LinkDB All DBs
Position
Unknown
AA seq 1005 aa AA seqDB search
MPSNTVTNTNTTAFKGSDFTDSPGNRMGESTILDMDLRTEEKLAKNSASCKVGKPGRKRK
QFPVESFGSLKDGVGVGNSYTGVGRPSMAQVHNGDVGGHRDRTSDACFPKQEKREVENGI
PRDPSSCRAEDSSHGQILSPSQENGFLPSREEQDSEKDKDDSLTTPRKKRGRRKLERPTK
YVEHKEEDGGDAVKTEGGRGRLRGGVGWEISLRQRPMPRITFQAGDPYYISKRTREEWLA
KWKMEAEKKAKLMSAMNAMKDHEENETETQKEEVSIIKHPQPSKQQQPQLQQPQSHTQCQ
SQPQYQQQSQPSLQSQQQQQLQQQQQHQQPPQQQQQQQPTDPASPTVATTPEPVAIVGGD
KACPKSADTEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWF
GDGKFSVVCVEKLMPLSSFNNAFHQPTYNKQPMYKKAIYEVLQVASSRAGKAFMACPDSD
ETETSKSVEMLNKQMIDWAMTGFQPTGPKALEPPEEERNPYKEVYPEMWVEPEAAAYTPP
PAKKPRKSTAEKPKVKDIIDERTRERLVYEVRQKCRSIEDICISCGSLNVSREHPLFAGG
MCQSCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGQGAA
HAAIKEDPWNCYMCGQKGVFGLLERRTDWPSRLQHFFANNHDQDFDAPKLYPPVMVEKRK
PIRVLSLFDGIATGLLVLKELGIQVDRYIASEVCEDSITVGIVRHQGRIMYVGDVRNVTR
KLIHEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHEARPKEGDDRPFF
WLFENVVAMGVSDKRDISRFLECNPVMIDAKEVSAAHRARYFWGNLPGMNRLVGEWPLTA
MCTDRLDLQGCLEHGRTAKFDKVRTITTRSNSIKQGKDQHFPVYMNEKEDILWCTEMERV
FGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKDYFACV
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaacactgtcaccaacaccaacaccactgcattcaaaggctcagacttcacc
gactcacctggaaacagaatgggtgagagcacaatactggacatggacctgaggacagag
gagaagttggctaaaaatagtgcctcttgtaaagttggcaagcctggaagaaagcgcaag
cagtttccagtcgagagctttggctccctcaaagatggtgtgggtgtgggcaacagctac
actggggtgggtaggccgtccatggcacaggtccacaatggagacgtgggcgggcacaga
gacaggacgtccgacgcctgttttcccaaacaggagaagagggaggtggagaacgggatc
cccagagacccttcctcctgccgggcagaggacagctcccatggtcagatcctgagccct
tcccaggagaacggattcctgcccagccgggaagagcaggactcggagaaagacaaggac
gacagcctgacaacaccgcgcaagaaaagagggaggcggaaactggagcgcccaacgaaa
tatgtggagcacaaggaggaggatgggggtgatgcagtcaagaccgagggaggtcgaggc
aggctgcgagggggagttggttgggagatcagccttcgtcagaggcccatgcccagaata
accttccaggctggtgacccttattacattagcaagcggaccagagaggagtggctggcc
aagtggaagatggaggcagagaaaaaggccaaactgatgtcagcgatgaacgcgatgaag
gatcacgaggagaatgaaacagagacccagaaagaagaggtctcaataataaagcacccg
cagccttcaaagcagcagcagccgcagctgcagcagcctcagtcgcacacccagtgtcag
tctcagcctcagtatcaacagcaatcacagccgtcgctgcaatcacagcaacagcaacag
ctacaacaacagcagcaacatcagcagccgcctcagcagcagcagcagcagcagcctact
gacccagcttcgcccactgtggccacgacccccgagcctgtcgccatcgtaggtggagac
aaggcgtgccccaagtctgcagacactgagcccgagtatgaggacggtcgtggttttggc
attggtgagctggtttgggggaagctgcgagggttctcgtggtggccaggccgcatcgta
tcctggtggatgacgggacggagcagagctgctgagggaaccagatgggtcatgtggttc
ggagatggaaaattctcagtggtctgtgtagagaaactcatgcctttaagttcctttaac
aatgcctttcaccaaccaacttacaacaagcagcccatgtacaagaaagccatctatgaa
gtgctacaggtggctagcagccgggcaggcaaagccttcatggcctgccctgacagtgat
gagacagaaacctccaaatcagtggaaatgctgaacaagcagatgattgactgggctatg
acaggatttcaacccactggacccaaggccttagagccaccagaggaggagcgtaaccca
tacaaagaggtttaccctgagatgtgggtggagccagaagcagcagcctacacgcctcct
ccagccaaaaagcctcgcaaaagcacagcagagaaacccaaggtcaaggacatcattgat
gagaggacacgggagcggctcgtttatgaagtgagacaaaagtgccgcagcatagaggac
atctgtatctcctgtggaagtctgaatgttagccgtgagcacccgctgtttgctggagga
atgtgccagagctgtaagaactgcttcctagaatgtgcatatcaatatgacgacgacggt
taccagtcatactgcactatctgctgcggaggacgagaggtgctcatgtgcggaaacaac
aactgttgtcggtgtttctgtgtggagtgcgtcgacctcctcgttggtcaaggcgccgcc
cacgctgccatcaaagaggacccgtggaactgctacatgtgcggtcagaagggcgtgttt
ggtctgttggagcgtcgcactgactggcccagccgtctccagcacttctttgcaaataat
cacgaccaagattttgatgcaccaaagctttaccccccagtcatggtggagaagaggaag
cccattcgtgtcctgtcgctatttgacggcatagcaacagggctgctggtgctgaaagaa
cttggcatccaggtagatcgctacatagcctctgaagtgtgtgaagactccatcactgtg
ggcattgtccggcatcagggtcgcatcatgtatgttggcgatgtgaggaacgtcacacgc
aaacttatacacgagtggggtccttttgacctagttattggtggaagcccatgcaatgac
ctctctatagtcaatcctgcgaggaaaggtctttacgagggcaccggccgcctgttcttc
gagttttacaggctgctccacgaggctcggccgaaggagggggacgaccggcctttcttc
tggctctttgaaaacgtggttgccatgggtgtcagcgataagagggacatctctcgcttt
ttagagtgtaacccggtgatgatcgatgccaaggaggtgtctgctgcccaccgtgcccgc
tacttctggggtaaccttcctggcatgaacaggttggtgggtgaatggcctttgactgcg
atgtgcactgacagactggacctccagggctgtttagaacacggcaggacagctaagttt
gacaaggtgaggaccatcaccaccaggtctaattccatcaagcagggcaaggaccagcac
ttccccgtctacatgaacgagaaggaggacatcctctggtgcactgagatggagagggtc
tttggttttccagtccactatacggacgtgtccaacatgagccgactggcgaggcagagg
ctcctgggcagatcatggagcgtcccggttatccgccacctgtttgcaccactcaaagat
tactttgcctgtgtttga

DBGET integrated database retrieval system