KEGG   Seriola dumerili (greater amberjack): 111225913Help
Entry
111225913         CDS       T05606                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00010  Glycolysis / Gluconeogenesis
sdu00053  Ascorbate and aldarate metabolism
sdu00071  Fatty acid degradation
sdu00280  Valine, leucine and isoleucine degradation
sdu00310  Lysine degradation
sdu00330  Arginine and proline metabolism
sdu00340  Histidine metabolism
sdu00380  Tryptophan metabolism
sdu00410  beta-Alanine metabolism
sdu00561  Glycerolipid metabolism
sdu00620  Pyruvate metabolism
sdu01100  Metabolic pathways
Module
sdu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111225913 (aldh2)
   00053 Ascorbate and aldarate metabolism
    111225913 (aldh2)
   00620 Pyruvate metabolism
    111225913 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111225913 (aldh2)
   00561 Glycerolipid metabolism
    111225913 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111225913 (aldh2)
   00310 Lysine degradation
    111225913 (aldh2)
   00330 Arginine and proline metabolism
    111225913 (aldh2)
   00340 Histidine metabolism
    111225913 (aldh2)
   00380 Tryptophan metabolism
    111225913 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111225913 (aldh2)
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111225913 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111225913
NCBI-ProteinID: XP_022606682
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLQTVFSRALPRLSRLSVCHYSAAAIPAPSTQPEVHYNKLFINNQWQDATSGKTFPTINP
ATGEVICQVAEADEADVDKAVKAARNAFRLGSPWRRMDASHRGLLLTRLADAIERDSAYL
AELETLDNGKPYAVSYTVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILP
GMGPSAGAAIAKSMDVDKVAFTGSTEVGHLIQQASGGSNLKKVTLELGGKSPNIILSDAN
MEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGNPFDLKTEQG
PQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEIFG
PVMQILKFKNLEEVVTRANDSKYGLAAAVFTKDIDKAHYVSNGLRAGTVWINCYDVFGAQ
APFGGYKASGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaccgtgttttctcgggccctgcccagactgagtcgactgtcggtgtgtcac
tactccgctgccgccatcccagcacccagcacccagcccgaggtccactacaacaagctg
ttcatcaacaaccagtggcaggatgcaacgagcgggaaaaccttccctaccatcaaccca
gcaaccggggaggttatctgtcaagttgcagaggctgatgaggcagatgtagacaaggcg
gtcaaagcagcacgtaacgccttcaggttggggtcaccatggcgacggatggatgcctct
catcgcggcctgctactcacccgactggctgatgccattgagagggattctgcatacctt
gctgagctggagaccctggacaacgggaagccttacgctgtttcctacaccgtggatctg
cccaacgtggtcaaatgtctcaggtactacgctggctgggctgacaaatgggagggaaag
accatccccatcgatggagattacttctgctacactagacatgaacccatcggagtgtgt
ggacagatcataccgtggaacttccctctgctgatgcaggcctggaaactgggcccagct
ctggcgacaggtaacacggtggtgatgaaggttgcagagcagactccgctcacagctctc
tacgtggccagtctcattaaagaggtgggcttccctgaaggggttgtgaacatcctgcct
ggcatggggccgtcagctggcgctgccattgcaaagagcatggacgttgacaaggtggcc
ttcactggctccacagaggtgggtcatctaatccagcaggcgtcaggcggcagtaacctg
aagaaggtcactctggagctgggagggaagagccctaacatcatcctgtctgacgccaac
atggaagacgcagtggaacagtcgcacttcgctctgttcttcaaccagggccagtgctgc
tgcgccggctctcggacctacgtccaggctgacatctacgatgagtttgtggagcggagc
gtggagcgagctaagagacgagtggtgggaaacccctttgacttaaagaccgagcaggga
cctcaggtagaccaggagcagttcaacaagattctgggctacatcagcagcgggaagaga
gagggagccaagctgatgtgtggaggaggagtggctgcagacagaggatacttcatccag
cccactgtgttcggagacgtccaggacaacatgaccatcgccagggaggagatctttggt
ccagtgatgcagatcctgaagtttaaaaacctggaggaggtggtgacgcgagccaatgac
agtaaatatggtctagcagccgctgtgttcaccaaggacatcgataaggcccactacgtc
tccaatgggctgcgtgccggcacagtctggattaactgttatgacgtgtttggggcccag
gctccgtttggaggttacaaggcctcaggtaacggcagagagctgggagagtacggtcta
gacaactacacagaagtcaagacggtgaccatcaaggtgccacagaagaactcttag

DBGET integrated database retrieval system