KEGG   Seriola dumerili (greater amberjack): 111226338
Entry
111226338         CDS       T05606                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04020  Calcium signaling pathway
sdu04144  Endocytosis
sdu04510  Focal adhesion
sdu04540  Gap junction
sdu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111226338 (pdgfra)
   04020 Calcium signaling pathway
    111226338 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111226338 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111226338 (pdgfra)
   04540 Gap junction
    111226338 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111226338 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdu01001]
    111226338 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sdu04090]
    111226338 (pdgfra)
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     111226338 (pdgfra)
Protein kinases [BR:sdu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   111226338 (pdgfra)
CD molecules [BR:sdu04090]
 Proteins
  111226338 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 111226338
NCBI-ProteinID: XP_022607147
LinkDB
Position
Unknown
AA seq 1472 aa
MDGVRTCVVFGGVLLALVSVTCGLSPPTIVSNQEEFILQPGSGLNISCTGKRSVVWAEPL
PENTFVLPGYFTSTLFVYNATVGNTRYYMCVYEGREGDLQSEEEEEENEAGIYVFVPDPE
AAFVPDTPENLVVPMDSLGVPISCRVSHPHSDVILRSVPGGEEMPAYYDNKMGFFGHLAP
GQYQCETAGVNGRTARSDIYTVKIEAPVEQEDFDVEVKASEESVRAGQPLNITCVAPTGP
GFQQQWLHPKKQAVDAVQKKHTLPDRVIYTLRIPQATSQDSGTYECSITSEISGEVRVGS
VAVTVFEENSFVALDHSGILAVESVSLLEETEYTILINAYPAPKVTWLKDGKAMTGNYYT
HTKTSRIEGNRYQSILTLRQPLEKDNGNYTITAASGSRTAHFSFILTVKASTAVMFLPSS
APVLLPQMDEMVVPLHTPFTLTCRGEAKLAWETPLDVPEQTQEDNSGLFVTTVTVDSAEA
MHTGYYTCFYSKNTTEEAEDSRIYIYVPDPDNPFVPSPVPFGNHVLFGHEEMEIHCRVSD
PSANVTLINVDTQQPVPSVYDSKRGALGVFTSGTYICKALINGEEHYSEEYIVHGWTGGA
GLHVELTAKRTALLVGDTVTVTCLARGSEILEDHWKYPGKLANRAVKTVHENKRDQEILY
TLTIPQASTKDSGIYSCSITDIITNENQTKHLAINVFASEFMSIQPQFREYESAELDEVR
EFRAEISSFPTARVTWLKDGNPLGDVTAEISTSLRPLSETSYMSVLTLIRAKEEDSGNYT
MRVENGNQIQDVGLNLEVKVPAVIVELMDIHHGSATGQAVVCITRGQPTPVVEWFVCKNI
KHCANDSSSWSPLLTNSTEISVDSHIDEDNNLESQVLFGHLENTLAVRCLARNEMASVSR
EVKLVSNGPHPELTVAAAVLVLLVIVIISLIVLVVVWKQKPRYEIRWRVIESVSPDGHEY
IYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPT
ARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNREN
FLSLNPEKNKKELDIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEMSNAS
KYSDIQRSNYDSPPLQKGSSEGEGDNLLSDDSNEGLSTTDLLSFTYQVAKGMEFLASKNC
VHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTT
LSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWN
SEPEKRPSFLGLSETVASLLPSSYKRHYERVNHEFLKSDHPAVTRVCMENDAYIGIAYKN
QGKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDDEYGKRNRHSSQTSEESAIETGSSSS
TFAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4419 nt   +upstreamnt  +downstreamnt
atggatggggtgaggacgtgtgtcgtgtttgggggggttctgttggcgctggtttcagtt
acctgcggactgtcgccaccgaccatcgtgtccaaccaggaggagttcatcctgcaaccc
ggctccggcctcaacatcagctgcaccgggaagaggagcgtcgtctgggccgagccgctg
ccggaaaacaccttcgttcttccgggatacttcacgtcgacgctcttcgtttacaacgca
acagtgggaaacacccgctattacatgtgtgtctatgaagggcgggagggcgacctgcag
agtgaggaagaagaggaagagaatgaggcgggaatttatgtctttgtgccagacccggag
gccgcatttgttccggatacccctgaaaacttggtggtgcccatggactcgctcggagtc
cccatctcctgccgcgtgtctcaccctcactcggacgtcatcctcaggagcgtccccggc
ggagaggagatgcccgcctactacgacaacaagatgggcttcttcggacacctcgctccc
gggcagtaccagtgcgaaaccgccggcgtgaacggccgcacggccagaagtgatatctat
actgtgaagatagaggcccccgtcgagcaggaggatttcgacgtggaggtgaaagccagc
gaggagagcgtgagagccggacaacctctcaacatcacctgcgtcgctcccaccgggccg
ggctttcagcagcagtggctccatcctaaaaaacaggctgtggacgcagttcagaagaaa
cacacgcttcctgaccgggtcatctacaccctgcgtatcccacaagccacctctcaggac
agcggcacctacgagtgctccatcacatcagaaatcagcggcgaggtcagagtcggcagc
gtggccgtcaccgtcttcgaggagaactccttcgtggctctggaccacagtgggattcta
gcggtggagtctgtcagccttttggaggagactgagtatactattctcatcaatgcctac
ccggcccccaaagtgacatggctgaaagatggaaaagccatgaccgggaactactacacc
cacaccaagacgagccgcattgaagggaatcggtatcagagcattctgacattacggcag
cctctggagaaagacaacgggaattacaccattacagccgccagcggctcccgcaccgct
cacttctccttcatcctcacagtgaaagcctccactgcagtgatgttcctcccgtcctcg
gcccctgtgctgctgccacagatggatgagatggtggtgccgctccacactcctttcacc
ttgacctgccgtggagaggcgaagctggcctgggaaacgccgctcgacgtgcccgagcag
acgcaggaggacaacagcggcctgtttgtcaccaccgtcactgtggatagcgccgaagca
atgcacacgggctactacacatgcttctacagcaaaaacaccaccgaggaggcggaggac
agcaggatctacatctatgtgccagatccagataatcccttcgtgccatcgccggtgcct
ttcggtaaccacgtcctgttcggccacgaggagatggagatccactgtcgagtgtctgat
cccagcgctaacgtgaccctgatcaatgtcgacacccagcagcccgtgcctagtgtttat
gacagcaagaggggggctttgggggtgttcacttctggaacctacatttgtaaggccctc
atcaacggagaggaacactacagcgaggaatacatcgtccacggctggacaggtggtgct
gggctgcacgtcgagctgacggccaagcggaccgctctgctggtgggggacaccgtcacg
gtcacctgtctggctcgggggtcagagattctggaagaccactggaaataccctggaaaa
ctggccaaccgtgccgtgaaaacggtgcatgagaataagagggatcaggagattctctac
accctgacgatcccacaggcttcaaccaaagacagcggcatctactcctgctccatcact
gatattattactaatgagaaccagacaaagcatctagctattaatgtttttgcgagtgag
ttcatgtccatccagccacagttcagagagtatgagtcagcagagctcgatgaggtccgt
gagttcagggctgaaatcagctccttccccacggctcgtgtcacgtggctcaaggatgga
aacccactcggcgacgtgacagcggagatctccaccagcctccggccgctcagcgagacc
agctacatgagtgttctcaccctgatccgggccaaagaggaggacagcgggaactacacc
atgcgtgtggagaatggaaaccaaattcaggacgttggtttaaacctggaggtcaaagtg
cctgcagtcattgtggagctgatggacatccaccacggctcagccacaggccaggctgtg
gtgtgcattaccagagggcagcccactcctgtggtggagtggtttgtctgcaagaacatc
aaacattgtgccaatgactcgtcctcctggtcccccctcctcaccaactccaccgagatc
tcagtggactcccacatcgatgaggataacaacctggagagccaggtcctgtttggtcac
ctagaaaatacactggcggtccgctgcttggccaggaacgaaatggcgtctgtcagcagg
gaggtcaaattggtgtctaatggccctcaccctgagctgactgtagctgctgctgtgctg
gtgctgctggtcattgtcatcatctcactcattgtgttggttgttgtctggaaacagaaa
ccacgatatgagatccgctggagggtcatcgagtccgtgagcccagacggccacgagtac
atctatgtggatcccatgcagcttccctacgactccagatgggagttcccccgtgacaga
cttgtgctcggtcgtatcctgggctctggagcctttgggaaggtagtggagggaaccgcc
tatggactcagccgctcccagcccgtcatgaaggtggcagtgaagatgctgaaacccaca
gcacgctccagtgagaaacaagctctgatgtctgaactgaagattatgactcatctcgga
cctcatctaaacatcgtcaacctcctgggagcgtgcaccaagtcaggccctatctacatt
atcacagagtactgcttctacggggacctggtcaactacctgcacaagaacagggagaac
ttcctgagcctgaacccagagaaaaataaaaaggagctggatatctttgggatcaaccct
gcagatgagagcagccggagttatgtgatcctgtccttcgagagcaaaggagactacatg
gacatgaagcaggctgacaacactcagtatgtgcccatgctggagatgagcaatgcctcc
aagtactcagacatccagaggtccaactacgacagcccccctctgcaaaaaggctccagc
gagggcgagggggacaacctgctgtcagacgactcgaacgagggcctcagcaccaccgac
ctgctcagcttcacctaccaggtggccaaaggcatggagttcctggcttccaaaaattgt
gtgcaccgggacctcgcagccaggaatgtgctcctctctcagggcaagatagtgaagatc
tgtgacttcggactggccagagacatcatgcatgacaacaactatgtctccaaagggagc
acttttctgccagtgaagtggatggcaccagagagtatttttgacaacctgtacaccacc
ctgagcgacgtctggtcctacggcatcctcctctgggagatcttctccttaggtggaacc
ccgtacccagggatggtcgtggattcgagcttctacaacaagatcaagagcggatacagg
atgtccaaacccgaacacgcacctcatgacgtgtatgagatgatgatgaagtgctggaac
agcgagccggagaagaggccttctttcctgggtctgagtgaaaccgtggcttctttgctg
ccctccagctacaagaggcattacgagagggtaaaccacgagttcctgaagagcgaccac
cccgctgtgactcgggtgtgcatggaaaatgacgcctacatcggcatcgcttacaagaac
cagggcaagctgaaggacagagagagcggctttgacgagcagcggctgagctccgacagc
ggctacattatccccctcccagacctggacccaatatctgatgatgaatatggaaagagg
aacagacacagctctcagacgtctgaggagagcgccatcgagacaggctccagcagctcc
acgtttgctaaacgtgagggtgagaccctggaggacatcacgctgctggatgagatgtgt
ctggactgtagtgacctggtagaggacagctttctgtga

DBGET integrated database retrieval system