KEGG   Seriola dumerili (greater amberjack): 111226535
Entry
111226535         CDS       T05606                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111226535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sdu03000]
    111226535
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sdu03310]
    111226535
Transcription factors [BR:sdu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111226535
Nuclear receptors [BR:sdu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111226535
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 111226535
NCBI-ProteinID: XP_022607452
LinkDB
Position
Unknown
AA seq 778 aa
MDKGGVKKITFRRDDLLSKLVYTESPEEGGLLKVAPHSAMSITSATSVVLPSSPLMQPGQ
VPNGLSNSPLPEELTSASFTATVGPFLEDPEPRGLTKDQRPHQQQLLQTQTSITFGRQIL
GDTLPQLDASIADITQSSMDSLIGGSDPNFFPMKTEDFSMDKGDQDPIDLDHAFDHIGKD
VDVHQKLFSDNTLDLLQDFELTGSPSDFYGGDDAFLSTLADDSLLGDVGSERDIKSTLVE
SSNSSGAVSVALNGSIMTSPDQSCSSMSTTSPQTPTTTLSALVKKEKDAGFIQLCTSGVI
KQEKTSAGQSYCQISGTSSTVIPSSNPISICGVSTSGGQRYHFGVSPSSSEAQQLKDQKP
VYLPVTTISGAWNRGQGVADTSAMQRPSEAFSSSPSYPTRPEGVPATSSPQGKGGTHKIC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKC
LMAGMNLEARKTKKLNRLKGNQLSNPPEVSPPPVESYSLVLPGKYQPQLVPTMLSLLKAI
EPDTIYAGYDSTLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCS
WLFLMSFGLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMADQCEQMLKISSEFVRLQVS
HDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLT
KLLDSMHEMVGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKVKAGSVKPLLFHQR
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggataaaggtggagtgaagaagataacatttagaagagatgaccttttaagcaaattg
gtctacactgaaagccctgaggagggaggtctgttgaaagtggctcctcacagtgccatg
tccatcacctctgccacctctgtcgttcttccatccagcccattgatgcagccaggacag
gttcctaacggcctcagcaacagcccccttccagaggagctcacctctgcctctttcact
gccactgtaggcccctttttggaagacccagagcccaggggcctgacaaaagatcagagg
cctcatcagcagcagttactccaaacacagacatccattacgtttgggcgtcaaattttg
ggggacactttgccccagttggatgccagcatagcagacattacccagtcctccatggat
tcacttattggtggatcagatcccaatttcttccccatgaaaacagaggatttctccatg
gataaaggagaccaggatcccattgaccttgatcatgcctttgatcacattgggaaagat
gtggacgtgcaccagaagttgttcagtgacaacactctggacctgctccaagactttgag
ctcactgggtctccctcagatttttacggaggggatgatgccttcttgtccactctggca
gatgattctttgcttggggacgttggctcagagagggacataaagtctaccttggttgag
agcagtaacagcagtggggcagtctctgttgctctcaatggtagcattatgacaagtcca
gatcagtcctgctccagcatgtccacaacatccccacaaacccctacaaccactttgtct
gcattggtgaagaaagaaaaagatgctggcttcattcagctctgcacctcaggtgtgatc
aaacaggagaagacgtctgcaggccagagttattgccaaattagtggcacgtcctccaca
gtcataccaagctctaaccccatttccatctgtggggtcagcacctctggaggacagcgg
taccactttggagtcagccccagtagcagtgaagctcaacagcttaaggatcagaagcca
gtgtatctcccagtgaccaccattagtggagcctggaacagaggccaaggtgtggcggac
acctcagcgatgcagaggcccagtgaggctttctcaagctctccatcatacccaaccaga
ccagaaggagtcccagctacatcctcaccacagggaaagggcgggactcataaaatctgc
ctggtgtgctctgatgaggcttcaggctgtcactatggcgttcttacctgtggcagctgc
aaggtcttcttcaagagagcagtggaagggcagcataattacctgtgtgctgggaggaac
gactgcataatagacaagatcaggaggaagaactgccctgcctgccgctaccgcaagtgt
ctaatggcaggcatgaacctggaagcacgcaaaaccaagaagttgaaccgcttaaagggc
aaccagctgagcaacccgcccgaggtgtctcctccaccagttgagtcttactccctggta
ctccctggtaagtaccagcctcaactagtgcccacaatgctgtccctgctgaaggccatc
gagccagacaccatctacgccggctatgacagcaccctgcccgacacctccacccgcctc
atgaccaccctgaacaggctgggcggccgacaggtcatctctgctgtcaagtgggccaag
gccctgccaggtttcaggaaccttcacctggatgaccagatgaccctgctgcagtgctcc
tggctcttcctcatgtctttcggtctgggctggaggtcgtaccaacagtgcaacggcaac
atgctctgcttcgcacccgacctcgtcatcaatgaagagcggatgaaactgccctacatg
gccgaccagtgtgagcagatgctgaagatttccagcgagttcgtccggctgcaggtttcc
cacgacgagtatttgtgcatgaaggtcctgctgctgctcagcacagtgccaaaggacggc
ctgaagagccaggcggtgttcgatgaaattcggatgtcgtacatcaaggagctgggaaaa
gccatcgtgaagcgtgaagagaactccagccagaactggcagcgtttctatcagctcacc
aagctgctcgactccatgcatgagatggttggtggactgctcagcttctgcttctacacc
tttgtgaataaatccctgagtgtggagttcccagagatgctggcggagatcatcagcaac
cagttaccaaaagtcaaggccggcagcgtcaaacctctcctcttccaccagagatga

DBGET integrated database retrieval system