KEGG   Seriola dumerili (greater amberjack): 111226537
Entry
111226537         CDS       T05606                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111226537
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111226537
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sdu04052]
    111226537
   00536 Glycosaminoglycan binding proteins [BR:sdu00536]
    111226537
Cytokines and growth factors [BR:sdu04052]
 Growth factors
  Growth factors (RTK binding)
   111226537
Glycosaminoglycan binding proteins [BR:sdu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111226537
SSDB
Motif
Pfam: FGF Fascin Ntox17 CDtoxinA
Other DBs
NCBI-GeneID: 111226537
NCBI-ProteinID: XP_022607453
LinkDB
Position
Unknown
AA seq 158 aa
MADGEVFTVEDQAVDSARLLLRDYRRLTRLYCMNGGHHLQILPDGTVQGQRDEGDVHTVL
KIKAVDTGVVVIQGTEAGRYLAMSDEGRLYSSHTVTDECYFLEKLEENHYNTYQAQKYQE
KNWYVALKKNGKPKLGPRTHIGQKAVFFLPRQLDDCGE
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcggatggagaagtgttcacagtggaggatcaggccgtggacagcgcccggctgctg
ctgcgggactacaggcggctgactcggctgtactgcatgaatggcggacatcacctgcag
atcctgcccgatgggacagtgcagggccagagggatgagggggacgttcacactgtttta
aagattaaagctgtggacacaggtgtggtggtgatccaaggcacagaagctgggcgatat
ttggccatgagtgatgagggacgtttgtacagttcacacactgtgactgatgaatgttac
ttcctggagaaactggaggagaaccactacaacacctatcaggctcagaaatatcaggag
aagaactggtacgtagctctgaaaaagaacgggaaacctaaactgggtccaagaacacac
atcggacagaaggccgtcttctttctgccccgacagctggacgactgcggggagtga

DBGET integrated database retrieval system