KEGG   Seriola dumerili (greater amberjack): 111226560
Entry
111226560         CDS       T05606                                 

Gene name
lpar4
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
sdu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111226560 (lpar4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111226560 (lpar4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sdu04030]
    111226560 (lpar4)
G protein-coupled receptors [BR:sdu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111226560 (lpar4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx DUF2569
Other DBs
NCBI-GeneID: 111226560
NCBI-ProteinID: XP_022607489
LinkDB
Position
Unknown
AA seq 354 aa
MASLVLNETGMEDCGIDDSFKYNLYSVVYSVVFVLGLITNCAALFVFCLRMKMRNETTMF
MTNLALSDLVFVFTLPFKVFYNVNRHWPFGDGLCKVSGTAFITNIYGSMLFLTCISVDRF
LAIVYPFRSRSIRTRRNAALVCAAVWLTIVGGGISVTFFSTINSTNRATTCFEGFSKSTW
RTYLSKITIFIEVVGFLIPLLVNLVCSSLVLRTLRRPVTVGHGCDSKRRVLRMILVHLGI
FIICFVPYNSILFLYALVRTQALASCTVERFARTLYPITLCLASLNCCLDPVVYYFTSES
FQKSLTMGGKGSGSRPESIPRSDTETQDTANTLPRDTHTLASNGKETKMSESQF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggctagtctggtgctcaatgagactggaatggaggactgtgggatcgatgactccttc
aagtacaacttgtactctgtggtctacagtgtggtcttcgtcctaggcctgatcaccaac
tgtgctgcgctctttgtgttctgcttgcggatgaagatgcgcaatgagaccacgatgttt
atgactaacttagcattatctgatttagtgtttgtttttacgctgccgttcaaggtcttc
tacaatgttaaccgccactggccgtttggagatggactttgtaaggtgtcaggaacagcc
ttcatcaccaacatctacggcagcatgctcttcctcacctgcattagtgtagaccgcttc
ctggcaatagtgtaccctttccgctcacgctccatccgcacacgcaggaatgcagcgctg
gtgtgtgccgccgtgtggctgaccatcgtagggggaggaatatcagtgaccttcttctcc
accatcaacagcacaaacagagccaccacatgcttcgagggcttctctaagagcacctgg
aggacctacctgtccaaaatcaccatctttattgaggtcgtgggctttctcattcccctg
ctggtcaacttggtatgttcctcgctggttctgcggacactgcgtcgcccggtaactgtt
ggtcatggctgtgacagcaaaagacgtgtcttacggatgattctggtccatctgggcatc
ttcatcatctgcttcgtcccttataactctatcctattcctatatgcgctggtgcggacc
caggccctggccagctgcactgtagagcgattcgcccgaactctctacccgatcactctg
tgcctggccagcctcaactgctgcctggaccccgtggtttactacttcacctcagagagc
ttccagaaaagcttgaccatgggaggaaaagggtccggctctcgccctgagagtatcccc
cgcagcgacactgagacccaggacacagcaaacactctccccagagacacacacactctg
gccagcaatggaaaagagacaaagatgtctgaaagtcagttctga

DBGET integrated database retrieval system