KEGG   Seriola dumerili (greater amberjack): 111226990
Entry
111226990         CDS       T05606                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
sdu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111226990
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111226990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sdu04030]
    111226990
G protein-coupled receptors [BR:sdu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111226990
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 111226990
NCBI-ProteinID: XP_022608047
LinkDB
Position
Unknown
AA seq 370 aa
MAMESSVSNACYYNHNVTYFYDWVGKKVSVTWTARDFVVIGLGLTVCLIVVLANLMVMVA
IFMNRRFHFPIYYLLGNMAAADLFAGIAYANLMLNTGPWTRTLTKEQWYIRGALIDISLT
ASVANLLAVAVERHQTILTMQLHSTMPKRRVVLLIVCIWAVGIIMGLVPSKFWNCECSLK
DCSTVAPLYSRRFLIFWAVLNLLTFFIMVAMYTHIFIYVRYRSQYVSQHTSEMQQRQTVI
NLMKTISMVLGAFVICWTPGLIILLLDGLLGKDSHANDYEKFCLVIAECNSLVNPIIYSL
RDHEMRRTFKRILCCLCWRGVAQQREPPPVEIDSPLSEETLGCVQKSEDQALCMPQDTNS
KEDSWTMPGV
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggccatggagagcagtgtgtcaaatgcctgctactacaaccataatgtcacctacttt
tacgactgggtgggtaaaaaagtcagtgtaacatggacggcgcgggactttgtggttatt
ggactgggcttgactgtgtgtctcatcgtagtcctggccaacctgatggtgatggtggcc
atcttcatgaatcgccgcttccactttcccatctactatctcctgggcaacatggctgca
gcggacctgtttgccggtattgcctacgcgaacctgatgttgaacacgggcccctggacc
aggactctcactaaggagcagtggtacatccgcggggctctgattgacatcagcctgaca
gcctctgtggccaacctgcttgctgtcgccgtggagcgccaccagaccattctcaccatg
cagctgcacagcacgatgcccaagcgtcgagtggtgctgctgatagtttgcatctgggct
gtgggcatcatcatgggcctggtgccctccaagttttggaactgcgagtgcagcctaaaa
gactgctccactgtcgctcctctctacagccgccgcttcctcatcttctgggcagtccta
aacttgctcactttcttcataatggtggccatgtacactcatatctttatctatgtaaga
tacaggagccagtacgtgtctcagcatacctctgagatgcagcagaggcagactgttatc
aacctgatgaaaactatttccatggttctgggcgcctttgtaatctgctggacccctggc
ctcatcattctcttactggacgggcttttgggtaaagacagccacgccaacgactatgag
aagttctgtttggtgatagctgagtgcaactctctggtcaaccccatcatctattccctg
cgagaccacgagatgcggaggacattcaagcggatcctgtgctgtctgtgctggagaggt
gtcgctcagcagagggagcctccacctgtagagattgactcacctttatcagaggaaacg
cttggctgtgtccagaagtcagaagatcaggccttgtgtatgcctcaggacaccaacagt
aaagaagacagttggacaatgcctggggtatga

DBGET integrated database retrieval system