KEGG   Seriola dumerili (greater amberjack): 111227544Help
Entry
111227544         CDS       T05606                                 

Definition
(RefSeq) MARVEL domain-containing protein 3-like isoform X1
  KO
K21099  MARVEL domain-containing protein 3
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    111227544
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sdu02000]
    111227544
Transporters [BR:sdu02000]
 Other transporters
  Pores ion channels [TC:1]
   111227544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL ICE2 zf-LITAF-like DUF4328
Motif
Other DBs
NCBI-GeneID: 111227544
NCBI-ProteinID: XP_022608800
LinkDB All DBs
Position
Unknown
AA seq 292 aa AA seqDB search
MSRPPRSNRGHRERNGDHRQYRDSHDDRRSSPDRSSSPPPYYPREADSPPKHVRDVPRVE
HHDSKCTHICSRRGIVLICSVLTNALVLICVVAAQMVSTGLSSASALGGFNINSNFNLQG
TELQKARELDMQYSQMRAPGIYGGLSFSLTFGVISLLFVVAGNKPPHLMSRKLLVGALLF
QAVGAVAYVVAVGLYLHFIISVNATEVCQQRERLYARSGYTWMNCDVGGADAAVALFGLI
TAILYTAGTVLTIQTVRRVKRYLQERKRREAERQRHRTQPQRAPQRAETSSV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtccgccccgttcaaaccggggacaccgggagagaaacggagaccaccgacaa
taccgggactcccacgatgatagacgttcatcaccagacaggtcttcctctccgcccccg
tactaccccagggaagccgattcccctcccaaacatgtgcgggacgtcccgcgagtggag
caccacgactccaaatgcacacacatctgctccaggagaggtatcgtgctgatctgctct
gtactgaccaacgccctggtcctgatctgtgtggtggcggctcagatggtgtcaacaggc
ctgtcctcagcctccgcgctgggcggcttcaacatcaactccaactttaacctgcagggc
actgagctgcagaaggcacgagagctggacatgcagtacagccagatgagagcgccgggg
atctacggcggcctctccttcagcctgaccttcggggtcatctcgctgctgtttgtggtc
gccgggaataaacccccccacctgatgtcgaggaagcttctggtgggggcgttgttgttt
caggcggtgggcgcggtggcgtacgtggtggctgtcggtctctacctgcacttcatcatc
agtgtcaacgccacagaagtttgccagcagcgggagaggctgtacgcacgcagcggctac
acctggatgaactgcgacgtgggcggggcggacgcagccgtggctctgtttgggctcatc
acggccatcctgtacaccgccggcacggtgctcacgatccagaccgtccgccgagtgaag
cgctacctgcaggagcgaaaacgcagagaggcagagaggcagcggcaccgaacccaaccg
cagagggccccgcagagggctgagaccagctctgtgtga

DBGET integrated database retrieval system