KEGG   Seriola dumerili (greater amberjack): 111227715
Entry
111227715         CDS       T05606                                 

Gene name
lpar3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111227715 (lpar3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sdu04030]
    111227715 (lpar3)
G protein-coupled receptors [BR:sdu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111227715 (lpar3)
SSDB
Motif
Pfam: 7tm_1 Dopey_N BBL5 DUF3742
Other DBs
NCBI-GeneID: 111227715
NCBI-ProteinID: XP_022609152
LinkDB
Position
Unknown
AA seq 356 aa
MAQQNQTCHYNESMGFFYNNIGADDKWDKTQLILVQVVGSLFCCFILVSNAMVIAAVITN
KRFHYPFYYLLANLAASDFLAGIAYVYLMFNTGEVSRQLTVKGYFIRQGLLDISLSASLS
NLLVIALERYISVMNWKVHSNLTKRRVTLLIVLVWAISILMGAVPSLGWNCICNLSDCSQ
LAPIFSRGYLVFWSASNLVVFLVMVAIYMRIYTYVKKKTSVLMPHTSGSINRKRTPIKLI
KTVMVVLGAFVICWTPGLVVLLLDGLNCKSCNVMKLKRWLLLLAVLNSVMNPCIYSYKDE
EMWTTFKNLMRCIGNGTRRQRSTKANARPLSSGQDTGTSHLPPEEIKNDDQRILKT
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcccagcagaaccagacctgtcattataatgagtccatgggcttcttctataacaac
attggcgctgatgataaatgggacaaaactcagctcatcctcgtccaggtggtgggctca
ctcttctgctgtttcatcctggtctccaacgccatggtgatagctgctgtcatcaccaac
aagaggtttcactaccctttctactatcttcttgctaacctcgctgcctcggatttcctc
gctggcatagcgtacgtgtacctcatgtttaacacgggcgaggtgtcgcggcagctcaca
gttaaaggatactttatccgccaaggcctgctggacatcagtctgtcagcctcactgtct
aacctgctggtaatagcactggagcgctacatctccgtcatgaactggaaagtccacagc
aacctgacaaagaggagggtgaccctgctgatcgtgcttgtgtgggccatctccatcctc
atgggggccgtgcccagtctgggctggaactgcatctgcaacctgagtgattgctcccag
ctggctcccatcttcagcaggggctacctggtcttctggtctgcgtctaacctggtggtg
ttcctggtcatggtggcaatctacatgaggatctacacctacgtcaagaagaagacgtcg
gtgctcatgccgcacacaagcggctccatcaaccgcaagaggacgcctattaagctcatc
aagacagtgatggtcgtgcttggggcctttgtgatctgctggacccccggcctggttgtt
ctcctgctggatggcctcaactgtaagagttgtaacgtcatgaaattaaaacgatggctg
ctgctcctggccgtactcaactccgtcatgaacccttgcatttactcttacaaggacgag
gaaatgtggacaacgttcaagaacctcatgcggtgtattggaaacggtactcggcggcag
cggtcaacgaaggccaacgccaggccgctcagctctggtcaggacacgggcaccagccac
ctcccgccagaggagataaaaaatgatgatcagcgtatactgaagacctga

DBGET integrated database retrieval system