KEGG   Seriola dumerili (greater amberjack): 111227789Help
Entry
111227789         CDS       T05606                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00020  Citrate cycle (TCA cycle)
sdu00190  Oxidative phosphorylation
sdu01100  Metabolic pathways
sdu01200  Carbon metabolism
Module
sdu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sdu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111227789 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111227789 (sdha)
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111227789 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 111227789
NCBI-ProteinID: XP_022609221
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MASVRAASRLLSKRVLSKTKAVPAAAVQGSRNFHFSIYGKKSAKVSDDISTQYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECKGVIALCMEDG
SIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEKD
HVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGVPTNYKGQVI
THSNGQDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAEENKPGEKLS
PLQPSAGEESVANLDKLRFANGSLRTSEIRLNMQKTMQAHAAVFRTGSVLKEGCDKMDAV
YQTLDDVKTFDRGIVWNTDLVETLELQNLMLNAVQTIHSAEQRKESRGAHAREDFKDRVD
EYDYSKPLQGQEKKPFEQHWRKHTMSYVDPKTGKVTLEYRPVIDSSLDEQDCAHVPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgtccgtgccgcgtcccgtctcctttccaagagggtactatctaaaacaaaa
gcagtccctgctgctgcagttcaaggctccaggaactttcacttctccatctatggcaag
aaaagtgccaaagtatcagatgatatctctactcagtacccggttgtggatcatgagttt
gatgctgtggtggtaggggctggaggggctggacttagggcagcctttggcctgtcagag
gctggtttcaacactgcttgcgtcaccaagctcttccccaccaggtctcacactgtcgct
gcacagggtgggatcaatgcagctctggggaatatggaggaggatgactggaggtggcac
ttctacgacacagtaaagggatctgattggctgggagaccaggatgctattcactacatg
actgagcaggctcctgcagctgtagtggagctggagaactttggcatgccgttcagccgc
accgaagatgggaagatctaccagagggcctttggaggtcagagtctcaagtatggaaaa
ggaggccaggctcaccgctgctgctgtgtagcagacagaacaggacattctctactgcat
acactttatggacggtcgcttcgttatgacaccagctactttgtggagtactttgccctg
gacctgctgatggaaaatggagagtgtaaaggagtaattgctctctgcatggaggacgga
tctattcaccgcttcagagccaagaatactgtcattgctactgggggttatggaagaacc
tatttcagctgcacatctgcccacactagtacaggagatggaaatgcaatggtgaccaga
gctggactgccctgccaggatttggagtttgtacagttccatcccaccgggatctatgga
gctggttgcctgatcacagagggttgccgtggtgagggcggtatcctcatcaacagtgag
ggagagcgcttcatggagcgctatgcacccaacgccaaggacctggcttccagagatgtg
gtgtctcgctccatgaccatagagatcagagagggcagaggtgtcggtccagagaaggac
cacgtgtacctgcagcttcaccacctgcctcctcagcagctggccacaagactgcccggt
atctcagagacggccatgatctttgctggagtcgacgtcacaaaagagcccatccctgtc
ctgcccactgttcattataatatgggtggagtacccacaaactacaagggacaggtgatt
actcatagcaacggacaggacaaggttgttcctggactgtatgcctgtggtgaggcggcc
tgtgccagcgtccacggtgctaaccgactgggtgccaactccctgctggatctggtggtg
ttcggcagagcctgcgccctcaccatcgcagaggaaaacaaacctggagagaaactgtcg
cctctgcagcccagtgcaggagaggagtctgtggccaacctcgacaagctgaggtttgcc
aatggaagcctgagaacctctgagatcaggctcaacatgcagaagaccatgcaggctcat
gctgcagtgttccgtaccggctctgtcctgaaggaaggctgtgacaagatggatgctgtt
taccagaccctggatgatgtcaagactttcgacagaggcattgtgtggaacacagacctg
gtggaaacattggagctgcagaatctgatgctgaacgccgtccagaccatccactctgct
gagcagagaaaggagagcaggggagctcacgccagagaggacttcaaggaccgtgttgat
gagtatgactactcgaagcccctgcagggtcaggagaagaagccatttgaacagcactgg
aggaaacacactatgtcctacgtcgatcccaagactggcaaggtaaccctggagtaccgc
cccgttattgacagctctctggatgagcaggactgcgctcacgtccctcccgccatccgc
tcttactaa

DBGET integrated database retrieval system