KEGG   Seriola dumerili (greater amberjack): 111227842
Entry
111227842         CDS       T05606                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00230  Purine metabolism
sdu01100  Metabolic pathways
sdu04020  Calcium signaling pathway
sdu04114  Oocyte meiosis
sdu04261  Adrenergic signaling in cardiomyocytes
sdu04270  Vascular smooth muscle contraction
sdu04371  Apelin signaling pathway
sdu04540  Gap junction
sdu04912  GnRH signaling pathway
sdu04914  Progesterone-mediated oocyte maturation
sdu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111227842
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111227842
   04020 Calcium signaling pathway
    111227842
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111227842
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111227842
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111227842
   04914 Progesterone-mediated oocyte maturation
    111227842
   04916 Melanogenesis
    111227842
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111227842
   04270 Vascular smooth muscle contraction
    111227842
Enzymes [BR:sdu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111227842
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053 fn3_4 OPA3 DUF3446
Other DBs
NCBI-GeneID: 111227842
NCBI-ProteinID: XP_022609288
LinkDB
Position
Unknown
AA seq 1155 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYIIIMCAVVYTTDKLASVLVASVGLAADII
LYLLCRFGLLPDRISRRVVPYALWVLIAAQIFCYLGLNYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQHQQEEVQGAALGRQLLANIVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMECLHGEFDVEPGNGGDRCD
YLRERGIDTYLVVVPKGPVGKNGINGVKLSVTSSNGNSPLLINTTECNGSANTACTTPEE
PDELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQALKGKH
TNRLSLRFVDPDLETRYSVEKEKQSGAAFCCSCVVLLFTAAMEALIDPWLIANYITFAVG
EVLLLILTICSLAAIFPRVFPKKLVSFSTWIDHTRWARNTWAMAAIFILTMADIMDMVSC
SLTTVAPSSSSSSSSTRSGPDGCLGNPKYYSYIAVLALMATTMLVQVSHMVKLTLMLLIT
VATGIVNIYSWRDIFDRYDMARFQDYRXGREEAAVTELVXAHTPGPGLSFLSSCVXXHTH
VFLCRSYLVPSKFTMTIMIFIMMVSFYYFSRHVEKLARTLFLWKIEVHEQKEKVYEMRRW
NEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEESINNGGIE
CLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMAASGVTPDVSNGYTCMKKEEQSDRE
RWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGLNKGGVLAGVIGARKPHYDIWGNTV
NVASRMESTGVMGNIQVVEDCYNILKEYGFRFVRRGPIFVKGKGELLTYFLKGRDKQGSF
INGSSVTLPHQVVDS
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgccccggaaccgagccttctctgagcccgagtactcggcagagtattcggcggactgc
tccgtgacgctgccctcagaccccgggcaggcggtggggcggacacatgaggtcacggtg
cggagctcaggatgctgcctctgtctgccgcggttcatgcgcctcaccttcgcacccgag
tctctggagaacctgtaccagacctacttcaggcggcagagacacgagaccttgctggtg
ctggtcgtgttcgccgccctcttcgacagctacatcatcatcatgtgtgccgtggtctac
accactgacaagctggcgtctgtcctagtggcctcagtgggactggctgcagatattatc
ctctacctgctgtgccgcttcggcctgctgccagaccgcatctccagacgggtggtgccc
tacgccctgtgggtgctcatagcggcgcagatattctgctacctgggtctgaactatgct
cgcttccaccaggccagtgacactgtgggttggcaggccttcttcagcttctcctttttt
ctgactctgcctctgaggctgacccccatcgtgctcatcaccactgtgtcctgcggggtc
cacactttggttctgggcgtcaccatcgcccagcatcagcaggaggaggtccagggggct
gcgcttggcagacagctgctggccaacatcgtgatctacgtgtgtgcgatcaccgtgggc
gtcatgtcgtactacatggctgacaggaagcatcggaaggccttcctggaggcgaggcag
tcactggaggtcaaactcaacctagaggagcagagccagcaacaggagcgtctgctgctc
tccatcctccccaagcacattgctgacgagatgctgcaggacatgaagaaggagcccagt
cagaaagagatgcagcagttcaacaccatgtacatgtacagacatgaaaacgtcagtatt
ctgtttgcagacatcgtgggcttcacccagctgtcgtcgtcctgcagcgctcaggagctg
gtcaaactgctcaacgagctgttcgctcgcttcgacaaactggccgcaaaatatcaccag
ctgaggatcaagatcctgggagactgctactactgcatctgcggcctgccggactacagg
gaggaccacgccgcctgctccatcatgatgggcctggccatggtggaggccatctcgtac
gtcagagagaaaacccagaccgacgtggacatgagggtgggagttcacagcggcaccgtg
ctgggaggagtgctgggtcagaaacgctggcagtacgacgtctggtccaccgacgtcact
gtggccaacaagatggaggctggagggatcccaggtcgtgtccacatctctcagagcacg
atggagtgtcttcatggagagtttgacgtggagcccgggaacggaggcgaccgctgtgac
tacctgagggagaggggcatcgacacctacctggtggtcgtccctaaagggcctgtggga
aagaatggcatcaacggtgtaaagctgtctgtgacctcgtccaatggaaactctccgctg
ctgatcaacaccacagagtgtaacggcagcgctaacacagcctgcaccacgccggaggag
ccagacgagctggacaccagggtggtgaatccgtccttccctaacccgcggagacggctg
cggctgcgggacctggcggagagagtgatcgatgctcaggagaacgagcaggagctcaac
aaactgctgaacgaggctctgctggagagagagacggtgcaggctttgaaggggaaacac
accaacaggctctccctgaggtttgtggatccggacctggagactcgttactccgtggag
aaggagaagcagagcggagcggccttctgctgctcctgtgtggtcctgctcttcactgca
gccatggaggcgctcatagacccctggctgattgcaaactacatcacctttgcagtggga
gaagtcctgctgctcatcctgactatctgctctctggccgccatcttccccagagtcttt
cccaagaagctggtgtcgttctccacctggatcgaccacacccgctgggcccggaacacc
tgggccatggcggccatcttcatcctcaccatggcggacatcatggacatggtgagctgc
tctctcaccactgtggctccttcctcttcctcgtcctcctcctccactcggtccggccct
gacggttgcctgggcaaccccaaatattacagctacattgctgtgcttgctctgatggct
accaccatgctggtccaggtcagtcacatggtcaagctcacactgatgctgctcatcacc
gtggccaccggcatcgtgaacatctacagctggagggacatcttcgaccgctacgacatg
gcccgtttccaggactacaggtgaggccgggaggaagctgctgtaacagagctggtgtga
gctcacacacctggaccaggtcttagtttcctgtcttcatgtgtttgataacacacacac
gtttttctctgcaggtcctacctggttccctccaagttcaccatgaccatcatgatcttc
attatgatggtcagcttctattacttctcccgacatgtggagaagctcgcccgcaccctg
ttcctgtggaagatcgaggtccatgagcagaaggagaaggtgtacgagatgaggcgctgg
aacgaagcgctggtgaccaacatgctgcctgaacacgtggcccgacacttcctgggatcc
aagaagagggacgaggagttgtacagtcagtcctacgacgagatcggagtcatgttcgcc
tcgatccccaacttctctgacttctacacagaggagagcatcaacaacggaggcattgag
tgtctgcgcttcctcaacgagatcatctctgactttgacagtctgctggatgagcctcag
ttccgctgcatcactaaaatcaagaccatcggcagcacctacatggcagcgtcaggtgtc
accccagatgtcagcaatggctacacctgcatgaagaaggaggagcagtcggacagggag
cgctggcagcacctggcggacctggcggactttgctctggccatgaaggtcacactcatg
aacatcaactaccagtcgttcaacaacttcatgctgcgcattggtctgaataagggcgga
gtcttagctggagtgatcggtgcccggaaaccccactacgacatctggggcaacactgtg
aatgtggccagtcgcatggagtccacaggggtgatggggaacatccaggtggtggaggac
tgctacaacatcctgaaggagtacggttttcgctttgtgaggcgggggccgatctttgtg
aaggggaagggggagctgctcacctactttctgaagggaagagacaaacagggctccttc
atcaacggctcctccgtcactctgcctcaccaggtggtggacagctag

DBGET integrated database retrieval system