KEGG   Seriola dumerili (greater amberjack): 111228049Help
Entry
111228049         CDS       T05606                                 

Gene name
mre11
Definition
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu03440  Homologous recombination
sdu03450  Non-homologous end-joining
sdu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    111228049 (mre11)
   03450 Non-homologous end-joining
    111228049 (mre11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111228049 (mre11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sdu03032]
    111228049 (mre11)
   03400 DNA repair and recombination proteins [BR:sdu03400]
    111228049 (mre11)
DNA replication proteins [BR:sdu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     111228049 (mre11)
DNA repair and recombination proteins [BR:sdu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     111228049 (mre11)
    BRCA1-C complex
     111228049 (mre11)
   NHEJ (non-homologous end-joining)
    MRX complex
     111228049 (mre11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2 DUF4194
Motif
Other DBs
NCBI-GeneID: 111228049
NCBI-ProteinID: XP_022609551
LinkDB All DBs
Position
Unknown
AA seq 695 aa AA seqDB search
MSSENTLDDEDTFKILIATDVHLGYLEKDAIRGNDSYNTLDEILKCAKTNQVDFILLGGD
LFHENKPSRRCLHNCITMLRQYCMGDTPIHFNILSDQTVNFNTTQFPWVNYQDENLNIAI
PVFSIHGNHDDPTGAEGLCALDLLGASGLINHFGHSQSVERIEISPILMQKGNTRLALYG
LGSIPDERLYRMFVNNQVTMLRPKEDQDEWFNLFTIHQNRSKHGPTNYIPEQFLDEFLDL
VVWGHEHECLIAPSRNEQQLFYVTQPGSSVATSLSPGEATKKHIGLLRVKGRKMNLQKIP
LKTVRQFFIQDVVLADYEDRFTPDTPQVTKKVEDFCYAKVVEMLEEAERERLGCPLTPEK
PLIRLRVDYSGGFEAFNTSRFSQKFVDRVANPKDIIHFLRRREQKEGIKDEVNVDYGKLL
KTTAVEGLRVEDLVKQYFEATEQTVQLSLLTEQGMGKAIQEFVDKDEKDAIQELITYQLE
KTQRHLQARGVITEQDIDAEIRRFRDSKKNTTEEENEIKEAMSRAKAHRLERGDDPLHSD
ISSEFADVAMDSDEESALFPPTTRGRGRGGRGRGGRGRGRGATGSEPKPAGRGRAQKSSA
TTQSRSIMQAFQAPSQKSSRTRATPSYTADEVAIDDSDEDISVMKAARPPPRPASSSSFT
KYSSQSQSSRGVAFDDSDDDDEDNPFKGPSHRSRR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgagaacaccttggatgatgaggatactttcaagatcctaattgctacagat
gttcaccttggttacctagagaaggatgcaatccgtggcaatgactcttataacacactg
gatgagatcttaaaatgtgctaagacaaaccaggtagatttcatcctgctgggtggagat
ttgttccatgagaacaagccatcacggcgatgcctccacaactgcatcactatgctcaga
cagtactgcatgggagacacgcccatacacttcaacatcctcagtgaccagaccgtcaac
ttcaacacaacccagttcccctgggttaactatcaggatgaaaacctgaacattgctatt
cctgtgtttagcattcatggcaaccatgatgacccaactggggctgaaggtctgtgtgcg
cttgatctgctaggtgcttctggtcttatcaatcacttcggtcactcccagtcagtagag
cgaatagagattagtcccattctcatgcagaaaggcaacaccaggttggccttatatggt
cttggttctatcccagatgagcgcttgtacaggatgtttgtcaacaaccaggtaaccatg
cttcgccccaaagaagaccaagatgagtggtttaacctcttcaccatccaccagaacagg
agtaagcacggccccacaaactatattcccgagcagttcctggatgaatttcttgacctg
gtggtgtggggtcacgagcacgaatgtttgatagcaccatccagaaatgagcaacagctc
ttctatgtgacccagcctggcagttctgtagcgacctccctgtcccctggagaggctacc
aagaagcacatagggctgctgagggtaaagggtcgtaagatgaacctgcaaaagatcccc
ctaaagacggtgcgtcagttcttcatccaggatgtggtgctggctgactatgaagaccgc
ttcacacctgatacaccccaggtcacaaagaaggtggaggacttctgctatgcaaaggtt
gtagagatgttagaggaagctgagagagaaagacttggatgtccgctcaccccagagaaa
cctcttattcgtctgagggtggactacagtggaggatttgaggcgttcaacacctctcgc
ttcagtcagaagtttgtggaccgcgtggccaacccaaaagacatcatccactttctcaga
cggcgtgagcaaaaggagggcatcaaagatgaggtcaatgttgattatggcaagctgtta
aaaaccacagcagttgaggggcttagagtggaggacctggttaaacagtactttgaggca
accgaacagacggtacagctgtccctgctgactgagcagggcatggggaaggccattcag
gagtttgtagacaaagatgagaaagatgccatccaggagctgatcacttaccagctggag
aagacacagcgccacctccaggccagaggagtaattacagaacaggatatagatgcagag
atcagacgattcagagactccaaaaagaacacaactgaggaggagaatgaaatcaaagag
gctatgagcagagccaaagctcaccgcttggagcgtggtgatgatcctttacactcagat
atatccagcgaatttgctgatgttgctatggactccgacgaggaatcagccctattccct
cccacaacgcgaggccgagggcgaggaggcaggggacggggtggccgagggagggggaga
ggtgcaactggctctgaaccaaagccagccgggcggggtcgtgcccagaaatcctcagca
acaacccaaagcagaagcattatgcaagcatttcaagctccatctcagaagtcgtctcgg
actagagccaccccatcttacacagcagatgaagtggctattgatgactcagatgaagat
atctcagtaatgaaagctgcccgaccgcctccaagaccagcatcgtcgtcgtccttcact
aagtacagctcccagagccagtcatctcgaggagttgcatttgatgacagcgatgatgat
gatgaggataacccgttcaaaggccccagccatcgttcacggagataa

DBGET integrated database retrieval system