KEGG   Seriola dumerili (greater amberjack): 111228235Help
Entry
111228235         CDS       T05606                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00512  Mucin type O-glycan biosynthesis
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    111228235 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sdu01003]
    111228235 (galnt9)
Enzymes [BR:sdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     111228235 (galnt9)
Glycosyltransferases [BR:sdu01003]
 O-Glycan biosynthesis
  Mucin-type
   111228235 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 111228235
NCBI-ProteinID: XP_022609793
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSEELIQLGRISDQRLRARNGKVSNLVD
RQSILQRLERLEDVVYNQLNGLAKPMGLVEGPGGLGQGGAAATLGEDSRDAEGKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQLTYPEDLPQISVVFIFVNEALSVILRSVHSVVNHTP
AHLLKEIILVDDNSDSVELKFNLDQYVNKRYPGLVKIVRNSKREGLIRARIHGWNAATAP
VVGFFDAHVEFNTGWAEPILTRMKEDHTRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNIP
MNNPGVDFGDVSERLALRKRLQCRSFRWYLEHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEDDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPSLKK
CDAVSRISQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggcacgcaaaatcaaaactttgctgaccgtcaacattttagtgtttgtgggg
attatcctgttctcggtgtactgcaggatccaggaccgatccgaggagctcatccaatta
gggcgtatttctgaccagaggctgcgagccaggaatggcaaagtttctaacttggtggac
aggcagtctattctccagaggctggagaggctggaggatgtggtctacaatcagttaaac
ggtttggcgaagcccatggggctggtggagggacccggaggccttggccaggggggagct
gctgccactcttggagaggacagtcgcgatgctgaggggaagtatgaggagtatggctac
aacgctcaactcagtgaccgcatctccctggacaggagcatccctgactacaggcctaaa
aagtgtaaacagctgacctatccagaggaccttcctcagatctctgtcgtcttcatcttc
gtgaacgaagcactgtcggtgatcctgcgatctgtccacagcgtggtcaaccacacacca
gcacacctgctcaaggagatcatcctggtggacgacaacagtgacagtgtggagctgaaa
ttcaacttggaccagtatgtgaacaaacgctacccaggcctggtaaagattgtgaggaac
agcaagcgggagggcctgatccgagccagaatacacggctggaacgcggccacggctcct
gtcgttggcttctttgatgcccatgtcgagttcaacactggctgggctgaacctatcctg
acccggatgaaggaggaccacacccgcatcatcctgcctgccatcgacaacatcaaatac
aacacgtttgaggtgcagcagtacgccaacgccgctcacggctacaactgggggctgtgg
tgtatgtacatcatccctccccaggagtggctggacaagggcgatgagacagcccctatc
agaactccagctatgattggctgctcgtttgtggtagatcgggaatactttggcgagatt
ggtctgctggatcctggcatggaggtctacggaggcgagaacatcgagctgggcatgcgg
gtgtggcagtgtggagggagtatggaagtcctgccatgtgccagagtggcccacatcgag
cgcaccaagaagccctacaacaatgacatagattactacgccaagcgcaatgccctgcgg
gccgctgaggtgtggatggatgaatacaaatcccacgtctacatggcatggaatattccc
atgaataacccgggggttgatttcggggatgtctcagagcgcttggccttaaggaagagg
ctacagtgtcggagtttccgctggtaccttgagcatgtctacccagagatgcggatctac
aacaacaccatcacatatggcgaggtgaggaacagcaaggccagtggctactgcctggac
cagggctctgaggacgacgacaaagctatcctttacccctgccacggcatgtcctcccag
ctggcccgctactctactgaggggcttctccagctaggacccctggggtcgaccaccttc
ctgcctgacacaaaatgtctggttgacgacggcagaggacgaactcccagtctgaaaaaa
tgcgatgcagtttcaaggatttcccagagactttgggactttacacagaatggtccaatc
atcagcagggacactggtcgatgcttggaggtagaaatgtccaaagatgccaactttggc
cttcgtctggtggtccagagatgctctggtcagaagtggatgatacgaaactggattaag
catcccaggcactga

DBGET integrated database retrieval system