KEGG   Seriola dumerili (greater amberjack): 111228789Help
Entry
111228789         CDS       T05606                                 

Definition
(RefSeq) cullin-3-like isoform X1
  KO
K03869  cullin 3
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04120  Ubiquitin mediated proteolysis
sdu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111228789
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    111228789
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sdu04121]
    111228789
   03400 DNA repair and recombination proteins [BR:sdu03400]
    111228789
Ubiquitin system [BR:sdu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     111228789
DNA repair and recombination proteins [BR:sdu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     111228789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 Phage_antitermQ
Motif
Other DBs
NCBI-GeneID: 111228789
NCBI-ProteinID: XP_022610548
LinkDB All DBs
Position
Unknown
AA seq 767 aa AA seqDB search
MSNLKGSTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAY
TMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDI
LMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGA
IRNACQMLMILGLDGRSVYEEDFEGPFLDMSAEFFQMESQKFLAENSASVYIKKVEARIN
EEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYKL
FSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKTRFDRFLLESFNN
DRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRFM
QEKDVFERYYKQHLGRRLLSNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNT
TMDEFRQHIQTTSASLSGVDLTVRVLTTGYWPTQSATPKCTIPPAPRHAFEVFRRFYLAK
HSGRQLTLQHHMGGADLNATFYGAVKKQEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTI
LMLFNNREKCTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFTV
NDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNV
LVAEVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacctcaaaggcagcaccaagaaggacaccaagatgaggatacgagcttttcct
atgacaatggatgagaagtatgtgaacaacatctgggaccttctaaagaatgccatccag
gagatccagaggaaaaacaacagtggactaagctttgaggaactgtacaggaatgcctac
accatggtgctccacaagcatggggagaagctctacacaggcctgagggaggttgtcact
gagcatctcatcaacaaagtacgagaagatgtcttaaactctctaaataataactttctg
caaacactgaatcaggcctggaatgaccatcaaactgccatggttatgatcagagacatc
ctcatgtacatggaccgggtctatgttcaacaaaacaatgtggagaatgtgtacaacctc
ggcctcatcatattcagagaccaggtcgtgcgctacggctgcattcgagaccacctgagg
cagacattactggacatgattgcacgtgagaggaaaggagaggttgtagacagaggagcc
atcagaaacgcctgccagatgttaatgattctcggcctggatggcaggtctgtatatgag
gaggactttgagggccccttcttagatatgtcagcggaattcttccagatggagagccaa
aagttcctagcagaaaacagtgcaagtgtctacataaagaaggtagaggccagaatcaat
gaagagattgaacgagttatgcactgtctggacaagtctacggaggagcccattgtcaag
gtggtggaacgggagttgatttctaaacacatgaagaccattgtagagatggagaactct
ggcctcgtccatatgctcaagaatggcaagacagaagacctggcatgcatgtacaagctg
ttcagtcgtgtgccaaatggcctgaaaacaatgtgcgagtgtatgagctcttacttgagg
gagcaaggcaaagctctggtgtcagaagagggagagggtaagaaccctgtcgactatatc
cagggcctgctagacctgaagacacgattcgatcgtttcctcctcgagtccttcaataat
gacagactcttcaaacaaaccatagctggcgactttgaatatttcctcaacctcaattcc
cgctctccagagtacctgtcactcttcatcgatgataagctcaagaagggagtcaaaggg
ttgacagaacaggaggtggagtcgatccttgacaaggccatggtgttgttcaggtttatg
caggagaaggatgtgtttgaaaggtactacaagcagcatctgggtcgcaggctgctcagc
aacaagagcgtctcagacgactccgagaaaaacatgatctctaagctcaagacagaatgt
ggctgtcagttcacttcaaaactggaagggatgttcagagacatgagcatctccaacact
accatggatgagttcaggcaacacatacaaaccacatcggcatctctaagtggtgtggac
ctcacagtaagagtcctcactactggctactggcccacacagtctgcaacccccaaatgt
accatccctcctgctcctagacacgcctttgaagtctttagaaggttttacctggctaag
cacagcggcagacagctcacactgcaacaccacatgggtggggcagacctaaacgcaact
ttctacggagctgttaaaaagcaggaggatggttcagaagtgggtgtgggaggtgcccag
gtgacaggctctaacacccgtaagcacatactgcaggtctctaccttccagatgaccatc
ctcatgctcttcaataacagagaaaagtgcactttcgaggaaatccagcaggagacggat
attcccgagcgagagttagtgcgagcgttgcagtctttggcctgtgggaagcccacacag
agagttctcaccaaggagccaaagtccaaggaaattgagaacggccacgtgtttacagtc
aatgatcagtttacttccaaactgcacagagtcaaaatacagacagttgctgctaaacaa
ggggaatcggaccccgagaggaaagagacgcggcagaaagtggatgacgacaggaagcat
gagatagaggcagccattgtccgaatcatgaagtcgaggaagaagatgcagcacaatgtc
ctggtggcagaggtgactcagcagctccgggcacgttttcttcccagtcctgtggttatc
aaaaagcgtatagaaggactaatagaaagagaatacttggcgaggacgccagaggatcgt
aaagtgtacacctatgttgcatag

DBGET integrated database retrieval system