KEGG   Seriola dumerili (greater amberjack): 111229694
Entry
111229694         CDS       T05606                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04012  ErbB signaling pathway
sdu04068  FoxO signaling pathway
sdu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    111229694 (cdkn1b)
   04068 FoxO signaling pathway
    111229694 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111229694 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111229694
NCBI-ProteinID: XP_022611840
LinkDB
Position
Unknown
AA seq 185 aa
MSDVRLSNGSPTLERTDPRVSDHPKPSACRSLFGFVDHEELKKDLKGHLREMEETASAKW
GFDFANHTPLANDRLQWELVDRRDVPDFYHRPHRREKGVCSAGNNNVDLNGNHNCVVVAP
SDDTDRSEAQMECTEQCTGLRKRPARHDPSAQNKRSHTSSDEVSCPSLSHSAEHTPRKTS
PKRQT
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacgggagcccgacgctggagcggacggacccccgtgtg
tcggatcacccgaaaccgtcagcctgcaggagcctcttcggcttcgtggatcacgaagag
ttaaagaaggatttaaagggacatttgcgggagatggaagagactgcctccgccaagtgg
ggcttcgacttcgccaatcacacgccgctggccaacgacaggctccagtgggaattagtg
gatcgcagagacgtcccggatttctaccaccggccgcaccggagggagaagggcgtctgc
tccgctgggaataacaatgtggatctaaatgggaatcataactgtgttgtggtagctccg
agcgatgacaccgacaggtctgaggcgcagatggagtgcacggagcagtgcaccgggctg
aggaaaagacctgcacgtcacgacccctcggcccaaaataagaggtcacacaccagctca
gatgaggttagttgtccaagtctgagccactctgcagaacacacacccagaaagaccagc
cccaagagacaaacgtga

DBGET integrated database retrieval system