KEGG   Seriola dumerili (greater amberjack): 111230270Help
Entry
111230270         CDS       T05606                                 

Gene name
gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00500  Starch and sucrose metabolism
sdu01100  Metabolic pathways
sdu04910  Insulin signaling pathway
Module
sdu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111230270 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    111230270 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sdu01003]
    111230270 (gys1)
Enzymes [BR:sdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     111230270 (gys1)
Glycosyltransferases [BR:sdu01003]
 Polysaccharide
  Storage polysaccharide
   111230270 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 111230270
NCBI-ProteinID: XP_022612663
LinkDB All DBs
Position
Unknown
AA seq 711 aa AA seqDB search
MPLARSLSVTSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTSEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNSSGCKVYFGRWLIEGSPYVVLIDVG
FTAWSLDRWKSELWDLCDIGVPWFDREANDAVLFGFLTAWLLGEYAAQSEEPPHIVAHFH
EWLAGLGLVLCRHRQLPVATIFTTHATLLGRYLCAGNVDFYNKLSEVCFNVDKEAGDRQI
YHRYCLERAATHCAHVFTTVSQITAIEAEYLLKRKPDIVTPNGLNVKKFSAMHEFQNLHA
QSKNRIQEFIRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHS
DVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSK
MLDKEDFTIMKRAIFATQRQCQPPICTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFH
PEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFM
EEHIADPSAYGIYILDRRYRGIDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDW
RYLGRYYIAARHMALAKAFPDTYLYEPHEPTSTSGFRYPRPASVPPSPALSRHSSPHHSE
AEDNDEDERYDEDLEAEKDRVNIRQPYTPPFKNKSVLGANGNSNGVISEKN
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgcagcctgtctgtcacgtccctctcaggactggaggagtgggatgag
gagtttgatttggaagatgccgtcctttttgaaattgcctgggaggtcgctaacaaagtt
ggaggcatctacactgtcatccagaccaaagcccgtctgacctcagaggaatggggggag
aactatttcctggtgggtccctatgtggaaagcaacgtgcgcactcaggtggagctgatc
gagcccaccaaccccgtgctgaagagaaccattgacaagatgaactccagtgggtgtaag
gtctactttgggcgctggcttattgagggcagtccctacgttgttctgattgatgtcggc
ttcactgcgtggtctctggaccgctggaagagcgagctttgggatctttgtgacatcggc
gtgccttggttcgaccgtgaggccaacgacgctgtgctgttcggcttcctgacggcctgg
cttctgggagagtacgcagctcagagtgaggagcctccacacatcgtggctcatttccat
gagtggttggctggcctgggcctagtgttgtgtagacatagacagctgcctgtcgcaacc
atcttcaccactcacgctacactgctgggacgatacctgtgcgctggaaatgtggacttc
tataataagctttcagaggtgtgtttcaacgtggataaggaagcgggcgacagacagatc
taccaccgctattgtttggagcgggcggctactcactgcgctcacgttttcaccactgtg
tcacaaattacagccatcgaggcagagtacctgctcaagaggaaaccagacattgtcact
cccaacgggctcaatgtgaagaagttctcagccatgcacgagtttcaaaacctccatgcc
cagagcaagaatcggattcaggagttcatcaggggacacttctatgggcaccttgacttc
aacctggacaagtgtttgttcctcttcatagctggaaggtatgagttctccaacaaagga
gctgatatcttcttggaggctttagcaagactcaactatctgctgagagtcaaccacagt
gatgtgaccgtcatcgcattcttcatcatgccagctcggacaaacaactttaatgtggaa
accttaaagggccaggcagtcaggaagcagctctgggatactgctcagactgtgaaggaa
cgctttggaaagaaactttatgagtcacttctggttgggcagctgccagatgtgtcaaag
atgctggacaaagaggatttcaccatcatgaagcgcgccatctttgcgactcagagacag
tgccagcctccaatctgcactcataacatgctggaggacagcagtgaccccatccttaac
tgtgtccgccgcattggccttttcaacagctctgctgaccgtgtcaagataatcttccat
ccagagttcctttcgtccacctctcctttacttccaatggattatgaggagtttgtaaga
ggctgccaccttggtgtcttcccctcttactatgagccttggggctacacacctgctgag
tgcacagtcatgggaattccatctatctcaactaacctgtcaggctttggctgcttcatg
gaggaacacatagcagacccctcagcctatggtatttacatcctggacaggcggtatcgg
gggatcgatgagtcgtgtaaccagctcacgtccttcctgttccagttctgcaagcagagc
cggcgccagaggatcatccaaaggaacaggactgagcgcctgagtgacctcctggactgg
agatacctcggcaggtattatatagctgctcgtcacatggccctggctaaagccttccct
gacacttacttatatgaacctcatgagcctacctcaacctcaggcttccgttacccccga
cctgcctctgtgccgccatctccagctctgtctcgccactcctccccccaccacagcgag
gctgaggacaacgacgaagacgaacgctacgacgaggatctggaggcagagaaggaccga
gtgaacatccgccagccctacaccccgccattcaaaaacaagtctgtcctcggggccaac
gggaacagcaacggtgttataagcgagaaaaactga

DBGET integrated database retrieval system