KEGG   Seriola dumerili (greater amberjack): 111230666
Entry
111230666         CDS       T05606                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04141  Protein processing in endoplasmic reticulum
sdu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111230666 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111230666 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sdu03000]
    111230666 (atf6b)
Transcription factors [BR:sdu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    111230666 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Chorion_2 MCU DUF4140
Other DBs
NCBI-GeneID: 111230666
NCBI-ProteinID: XP_022613183
LinkDB
Position
Unknown
AA seq 732 aa
MSTELLSELDSRFFADNLLTSEDWDACLYQCDSMEEGEDADLSRGLKYDTSFDNDLVLTL
DPDNPTSPWRHSDENLLTGDTPVIKNEMTITQPLPVEMLFQVKAEPLSPASSLGSDCSIS
SPDPQITVKGENPPTPPYMYGDVLSPPLGSMEVTVATTAVPPPQTQLPALTQAQLQTPLT
TPIPAVISGLQTQAAVLPSSATLKASTIMNTKPPIQPRPVCVTTLPVPQTPAPAKTLILQ
GLPSMDQTRPVVLSQSVCLGSAPAIVKMEPVSPSIPQHCSSPTAPPASKPIVPATTTLPG
NNSSDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALR
ERLAGKEGSDSASNKRAVCVMAVLLFMTFSFGPVSITDKKLSTGLQDSVMSYTGRRLLEI
EQQQQQQQQQQQQQQQPVAAQPPSRVEDKTETEEDGGEAERYAPESYHFRNLSDVFSDMK
DLVLQDIDRYFSSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIAKKAKIAQK
AQLRKTNFSRYLPIQAHRSIESQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLL
PAISHNKTSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSL
RDPPPPPPSSHHNPHHHHHGNHTSLRGRHQHHPSSSSSPSSSSSSSSSSSPRQPLPARRR
TAEYFISQSEGV
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgagcacggaattactatcggagttggacagccgattcttcgctgataaccttctgacc
agcgaagactgggatgcctgcctgtaccagtgtgacagcatggaggagggagaggacgcg
gacctcagccgagggttgaaatacgacacgtcgttcgacaatgaccttgtgctcaccctc
gatcctgacaaccccacatcaccatggcgacacagtgacgaaaacctgctcacaggcgac
acgccggtgataaaaaatgaaatgacgatcactcagccgttaccagtggaaatgttgttc
caggtgaaagcagagcctctctctccggcatcttcactcggctccgactgctccatatcg
tcaccagacccacagatcacagttaaaggcgaaaaccctccgactcctccgtacatgtat
ggagacgtgctgtctcctccgctgggatccatggaggtaaccgtggcaacaacggccgtg
cccccaccgcagacgcagttacctgctctgacacaggcgcagctgcagacgccgttaacg
acaccgattcctgcagtcatcagtggattacagacacaggctgcagtcctgccaagttca
gccacattaaaggccagcaccatcatgaacacaaaacctcccattcagcccagacctgtg
tgtgtcaccaccctacctgtccctcagacccccgcaccagccaagaccctcatactgcag
ggcctcccctccatggaccagaccagacctgtcgtcctgtctcagtccgtctgcctcggc
tcggctccggccatcgtcaaaatggagccggtctctcccagcatcccccagcactgttcc
agccccacagccccacccgccagcaaacccatcgtcccggcgaccacgactttacccggc
aacaactccagtgatatcgacatgaaggtgttgaagcggcagcagaggatgataaagaac
cgggagtcggcctgccagtcgaggaagaagaagaaggagtacctgcagaacctggaggct
cagctcagggaggcccagcaggagaacgaacgactccgcagggagaaccaggcgctgagg
gagagactggccgggaaagagggcagcgactctgcgagtaacaagagagccgtttgtgtc
atggccgttctgctcttcatgaccttcagcttcggacccgtcagcatcacagacaagaag
ctgtcgacgggtctacaggacagcgtgatgtcgtacacaggacgacggctgctggagatc
gaacaacaacagcaacagcagcagcaacagcagcagcaacagcaacagccggtggctgct
cagcctccaagcagagtggaggacaagacggagacggaggaggacggaggagaggcagag
agatacgctccagagtcgtatcacttcaggaacctgagtgacgtcttcagcgacatgaag
gacctggttctccaggacatcgatcgttacttctcctcctccgactgcagacagttcaac
cgctctgagtccctcaggctggcagacgagctgagaggttgggttcaccgacaccagatc
gacaggaagaaatctggaggaaaaccaaagatcgccaagaaggccaaaatcgcgcagaaa
gctcagctgaggaagacaaacttctccagatatctgcccattcaggctcatcgctccata
gagagtcagctgcaggtgcttcccggtccggaggtcacgtacagcgacttcctggacgcc
atcgaccgcagggaggacacgttctacgtcgtctctttcagacgggaccacctgctgcta
ccagccatcagccacaataagaccagcagacccaaaatgtctctggtgatgccggccatg
tccgtcaacgagagtctgtataactcctctcagggctacgagatgatgatgcaggttgac
tgtgaggtcatggacacccgaatcgtccccatcaagtcctccgctgtcccgccatccctc
cgcgaccctcccccacctcccccctcctcccaccacaaccctcaccaccatcaccatggc
aaccacacctcactccgaggacgacaccaacatcacccgtcctcctcctcctcaccgtcc
tcctcctcctcctcctcctcctcctcgtctccgaggcaacctttacccgcccgccgacgg
acagctgaatatttcatcagccaatcagaaggggtgtga

DBGET integrated database retrieval system