KEGG   Seriola dumerili (greater amberjack): 111230864Help
Entry
111230864         CDS       T05606                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04068  FoxO signaling pathway
sdu04110  Cell cycle
sdu04115  p53 signaling pathway
sdu04210  Apoptosis
sdu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111230864
   04068 FoxO signaling pathway
    111230864
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111230864
   04210 Apoptosis
    111230864
   04115 p53 signaling pathway
    111230864
   04218 Cellular senescence
    111230864
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sdu03036]
    111230864
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111230864
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111230864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 111230864
NCBI-ProteinID: XP_022613458
LinkDB All DBs
Position
Unknown
AA seq 159 aa AA seqDB search
MTLEEIRGQDNTMENADRVQSAGAALEELLVAAKKQDYLTVGVYESAKVMNVDPDSVAFC
VLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGADGTGEPKDAHCIL
VTSPSANPWKDPALDKLSLFCEESRSVYDWVPTITLPER
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagagatccgcggacaagacaacacaatggaaaacgcagatagggtgcaa
agtgcaggcgcagccctggaagagctgctcgtcgctgctaagaagcaggactatctgaca
gttggagtttatgaatctgctaaagtcatgaatgttgacccagacagcgtggcattctgc
gtcctcgccaccgatgaggagtacgagtgtgatattgctcttcagatccacttcaccctc
atccaggctttctgctttgacaacgacatcaacgtggtgcgcgtaaacgacatcgagcgc
ctggcggacctcgtgggtgcagacgggaccggcgagcccaaggacgcgcactgcattctt
gtcacgagccccagtgcaaacccatggaaagaccctgctctggacaagctgagtctgttc
tgtgaggagagccgcagtgtgtacgactgggtgcccaccatcacactcccagagcgctga

DBGET integrated database retrieval system