KEGG   Seriola dumerili (greater amberjack): 111232901Help
Entry
111232901         CDS       T05606                                 

Definition
(RefSeq) trypsin-3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111232901
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sdu01002]
    111232901
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdu04147]
    111232901
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     111232901
Peptidases [BR:sdu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111232901
Exosome [BR:sdu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111232901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 111232901
NCBI-ProteinID: XP_022616317
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MKAFILLALFAVAYAAPIEDEDDKIVGGYECRKNSVPYQVSLNAGYHFCGASLISSTWVV
SAAHCYKSRVQVRLGEHNIAVNEGTEQFINSAKVIRHPRYSSRNLDNDIMLIKLSKPATL
NNYVRTVSLPSSCASSGTRCLISGWGNTSSSGSNYPDRLRCLDAPILSDSSCRSSYPGQI
TSNMFCAGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNKPGVYAKVCNYNSWI
RSTMSSN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcattctacttgctctgttcgcagtggcatatgccgctcccattgaggat
gaggatgacaagattgttggaggctacgagtgcagaaagaactctgttccctaccaggtg
tctctgaacgctggctaccacttctgtggagcttccctgatctccagcacctgggtggtg
tctgctgctcactgctacaagtcccgcgtccaggtacgtcttggtgagcacaacatcgct
gtcaacgagggcaccgagcagttcatcaactctgccaaggtcatccgtcaccccagatac
agcagccgcaacctggacaatgacatcatgctgatcaagctgagcaaacccgccaccctg
aacaactacgtccgcaccgtttccctgccatccagctgcgccagctctggcacccgctgt
ctgatctctggatggggcaacaccagcagctctggaagcaactaccctgatcgcctgagg
tgtctggatgcccccatcctgagcgacagcagctgcaggagctcctaccctggacagatc
acctccaacatgttctgtgctggattcctcgagggaggcaaggactcctgccagggtgac
tctggtggccccgtggtgtgcaatggtcagctgcagggtgtggtgtcctggggttacggc
tgtgcccagaggaacaagcctggagtctatgccaaggtctgcaactacaactcctggatc
cgcagcaccatgtcctccaactaa

DBGET integrated database retrieval system