KEGG   Seriola dumerili (greater amberjack): 111233862Help
Entry
111233862         CDS       T05606                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00010  Glycolysis / Gluconeogenesis
sdu00030  Pentose phosphate pathway
sdu00051  Fructose and mannose metabolism
sdu00052  Galactose metabolism
sdu01100  Metabolic pathways
sdu01200  Carbon metabolism
sdu01230  Biosynthesis of amino acids
sdu03018  RNA degradation
Module
sdu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111233862
   00030 Pentose phosphate pathway
    111233862
   00051 Fructose and mannose metabolism
    111233862
   00052 Galactose metabolism
    111233862
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    111233862
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sdu01009]
    111233862
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sdu03019]
    111233862
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     111233862
Protein phosphatases and associated proteins [BR:sdu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111233862
Messenger RNA biogenesis [BR:sdu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     111233862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 111233862
NCBI-ProteinID: XP_022617484
LinkDB All DBs
Position
Unknown
AA seq 793 aa AA seqDB search
MAGAAAPKRQDTRKFFENLSGAGKSIAVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIH
EGYQGMVDGGDNIKEATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVLRSITN
LCVIGGDGSLTGANLFREEWSSLLDELQQQGLIDAEAARSNSELHIVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDCHNKAITPDYIKDLVVRCLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASANTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFDDAVRLRGRSFENNLSTYRLLSYRKADSELPNSSFNVAVLNVGAP
AAGMNAAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKR
TLPGKHLDKIAEQMRIHNINALLVIGGFEAYVGLLELSSARDKYSELCVPMVMVPATVSN
NIPGSDLSIGSDTALNAITDTCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGAD
TVYIYEEPFDIRDLQANVEHLTQKMKTSIQRGLVLRNENCNENFTTDFVYQLYTEEGRGV
FDCRKNILGHMQQGGAPSPFDRNFGTKVAAKAIQWITQTLKDSYKGGRVFANSEETACLL
GMRRRALVFQPVSQLRDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVA
RLRPKETKTSSAI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagcggcggcaccgaagcggcaggacacccggaaatttttcgagaatctgtcc
ggcgctggtaaatccatcgcagtgttgaccagcggaggagatgcccaaggcatgaacgca
gccgtcagggcggtcgtccgaatgggcatctacgtaggagcgaaggtctacttcatccac
gagggttaccagggtatggtggacggtggagacaacatcaaagaggcgacgtgggaaagc
gtctccagcatgttgcaagtgggtggcacagtcatcggcagcgcccgctgtaaagaattt
cgtacccatgagggccgtctgaaggcggcacacaacctcgtgctgcgcagcatcaccaac
ctgtgtgtgattggtggagacggcagcttgaccggagccaacctgttcagagaggagtgg
agcagcctgttggatgagctccaacagcaaggtctgatcgacgcggaggcagcccgcagt
aactcggagctccacattgttggtatggtcggctccatcgacaatgacttctgcggcact
gacatgaccattggcaccgactcggcccttcatcggatcattgaggtggtggacgccatc
atgaccaccgctcagagccaccagaggacatttgttctggaggtcatgggcagacactgc
ggatacttggccctggtcagtgccctggcatgtggggcagattgggtttttatccctgaa
atgccccctgaagatggctgggaggataacatgtgtcagaaactgtctgagaaccgtgct
gataagaaaaggctgaacattattattgtagccgagggtgccatagattgccacaacaag
gctataactcctgattatatcaaggatctggtagtccgctgcctgggttttgacaccagg
gtcactatcttgggccatgtgcagagaggtgggaccccctctgcctttgacaggatcctg
gccagtcgtatgggcgtggaggcagtgctggcgttgttggaggcgtctgcgaacaccccg
gcctgcgtcgtgtctctggtcggcaaccaggctgttcgactgccacttatggagtgtgtt
cagatgacccaggaagtacagaaggccatggatgagaagaaatttgatgacgcagtcagg
ctgcgtgggaggagctttgaaaacaatctgagcacctacagactcctctcctaccggaaa
gcagactctgaacttcccaatagctcgtttaacgtggcggtgttgaacgtcggtgcaccg
gcagcaggtatgaacgctgccgtgcgctctgccgtcagagtgggaatcactgaaggccac
aagatgtttgctgtcaatgacggcttcgagggattttacaaaggacagatcaaggagatc
aaatggggagatgtaggtggttggactggccagggaggatcgctgctagggacaaaaaga
actcttccaggcaaacatctggataaaattgctgagcagatgaggatccataacatcaat
gccctgcttgtcatcggaggatttgaggcctacgtgggattactggaactttcttctgct
cgggacaaatatagtgaactctgtgtgcccatggttatggtccccgccaccgtctccaac
aatatacctggttcagacctcagcattggctcagacactgctctgaatgccattactgat
acgtgcgaccgcatcaagcagtcggccagtggtaccaagcggagagttttcatcattgag
actatgggcggctactgcggctacctggccactgtgggcggtctggccgctggcgccgac
accgtctacatctatgaggagccgtttgacatcagggacctgcaggccaacgtggagcat
ctgacgcagaagatgaagacgagcatccagagaggcttagtgctcaggaatgagaactgc
aacgagaacttcaccactgatttcgtctaccagctgtacactgaggagggtcggggagtg
ttcgactgcaggaagaacatccttggccacatgcagcagggaggagctccatctccattt
gatagaaactttggcaccaaagtcgctgctaaagccatccagtggatcacgcagacgctc
aaggactcttacaaaggagggcgagtgtttgctaactcggaggaaactgcgtgtctgttg
gggatgcggcgcagagctctggtcttccagcctgtgtcacagctccgggacgagaccgac
tttgtccacaggatccctaaggagcagtggtggctgaagctccgcccactgatgaaaatc
ctggccaagtacaagacgagctacgacgtgtccgactccggccagctggagcacgtggcc
cggctccgacccaaagagaccaaaacctcatcggccatctga

DBGET integrated database retrieval system