KEGG   Seriola dumerili (greater amberjack): 111234824
Entry
111234824         CDS       T05606                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04068  FoxO signaling pathway
sdu04110  Cell cycle
sdu04115  p53 signaling pathway
sdu04218  Cellular senescence
sdu04310  Wnt signaling pathway
sdu04340  Hedgehog signaling pathway
sdu04371  Apelin signaling pathway
sdu04510  Focal adhesion
sdu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111234824
   04340 Hedgehog signaling pathway
    111234824
   04371 Apelin signaling pathway
    111234824
   04068 FoxO signaling pathway
    111234824
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111234824
   04115 p53 signaling pathway
    111234824
   04218 Cellular senescence
    111234824
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111234824
   04530 Tight junction
    111234824
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 111234824
NCBI-ProteinID: XP_022618724
LinkDB
Position
Unknown
AA seq 293 aa
MEPQLLCCEGDRPARAYRDSNLLTDRVLRALLRAEDKYLPASNYFKCVQREIAPYMRRIV
ATWVLEVCEEQKCEEEVFPLAMNYMDRFLSVEPTKKNHLQLLGAACMFLASKLKETIPLT
AEKLCIYTDNSITPTQLLQMELLVLNKLKWDLASVTPLDFIDHFLFELPVRTDSRLILRK
HAQTFVALCATDVKFIASPPSMVAAGSMVAAVEGLQMKMVGNAMMSQKLTEKLAQTIRSD
PDCLRACQEQIESLLETSLRHAQQQHSVTMETKNIGEGQDLSTTPTDVRDINI
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaaccgcagttgttgtgctgtgagggggacaggcctgccagggcctaccgggactcc
aacctgttgactgaccgggtcttgcgtgcgctcttgcgggcagaagacaagtatctcccc
gcttcgaactacttcaaatgcgtccagagagaaatagctccgtacatgaggaggatagtg
gcgacctgggtgctggaggtgtgtgaggaacagaagtgtgaggaggaggttttccctctg
gctatgaactacatggaccgcttcctgtctgtggaacccaccaagaagaaccacctgcag
ttactgggagctgcctgtatgttcctggcctccaaactgaaggaaacaatcccgctcact
gctgagaaactctgcatctacacagacaactccatcacacctactcaactgctgcaaatg
gagctgctggttttgaacaagctgaagtgggacctggcctcagtgacccctctggacttc
attgaccacttcctgtttgagctgccagtcaggacggacagcaggctcatactcaggaag
cacgctcagacctttgtggctctgtgtgccacagatgttaaattcatagccagccctcca
tccatggtggcagccggcagcatggtggcagcagtggagggcttacagatgaaaatggtg
ggcaatgccatgatgtcacagaagctgacagagaagctggcacagaccatcaggagtgac
ccggactgtctcagggcgtgtcaggaacaaatcgagtcactgctggaaaccagtctcaga
catgcacaacagcaacactcagttaccatggaaactaagaacatcggtgaggggcaggac
ctctcaactacgcccacagatgtccgcgacataaacatctga

DBGET integrated database retrieval system