KEGG   Seriola dumerili (greater amberjack): 111236791Help
Entry
111236791         CDS       T05606                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    111236791 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sdu03036]
    111236791 (setd2)
Enzymes [BR:sdu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111236791 (setd2)
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111236791 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS
Motif
Other DBs
NCBI-GeneID: 111236791
NCBI-ProteinID: XP_022621372
LinkDB All DBs
Position
Unknown
AA seq 2634 aa AA seqDB search
MDTLLREEGSGASVKVEGLSKAALMKSLSPRVMLSNHLLPKGTKTKVNLEDQGRQKVSFS
FSHTKKPLQSLFFIPASPDKTVAEPQAALSQSVSDKGGQSTDSKTEQKQTPVVPTSIAET
PSQTPVSSATKLKPDLAKMHFKKQLLSVSVTEEKPTSFMPEEQLSSELQFLQKSASKSAT
EFPTPQSQNVVDVCPSENAHIEASEMRVTPSLKKPAASSGKDGETSSSTEQDKVYKRKTR
SQSNSAPPGSESDGDSVQMSSSCKSVDSKSKTNSDSRSKEVKKSSSGSHVEEKEKSCSKR
SENHERSSSYSKSDRDSRHTSSRSARSDKDRRRSRSRSRSRSRGSRTSSSHSRSERSRGD
RGSRSERSYYHDSDRRSHRSSPRRERRRSRSRTDRTRDSSDSEDDHRKTRTRTSDSSRSS
VHSSSHKESKSSSSYSKSEKVSKSVDSPHSSEIDKRTQSSKSERTSKRLSDSDSQRKCSP
DLDSSYRKPSIHHKSETNNKSSSSSMHTHSQTHEKCQKSSSSDSEADHKGKSSQGFDKSS
GSEEKSKNSLKKTSRPDSKQMTPSRSSVKTTGHDRQSDDMFHSSSKAPSCATTTELCSQS
EKEKSDSHQDGNELGNQDVKEIVSCTEKGLQEPSSTRAKETKSGLEVENKDTSAITSSES
LKHVNASLENLTNVKDSLSSNQPHVNSDAAVLNSCSSTESIVYSQEKKVVGCSPGPKSSP
DIADVPVTHNVQQNTKQETVELNMVEKQSDTSMPLKLESLCPEPENQHTCGQQSIDTVKK
SGGTTKKSRWDIVGQDTSESDNSQRMLSAESKPTVKKVISVKKIEFSKDNSQQDSDIKDN
IQPEPETHSTLVKQTEISKQEVGSDSTSMIDKYKDQSEPSRASTSIDHCDLKLTVSQKTN
TDEPLHINDTSQVDAAAKINSWNGNDLNETSKDSGHKNKLSKRTSLHQDALGGQSEGSDS
DNSEYDSDCGEAIKRLHSVVVVPKNSSLTMDTKDTGASCSPMNISELHNANTAADMNTHE
VPNEVSSQQRQSPSTVFGETSGPFAGVNNSSNSSMLCQSQSNMIDSTSHSEGSSTISALP
YMAGRISAHGSATDPAHSLDNSRQCEQGHKQHTLSSRGERLYSHYQQGDFSNADNINDKN
GFILGWEFSQTEQPSSTYQQPDSSHGPQLTNTKLVGNSPKGQEHRQNNAIWNHQSPNMQT
SRKPYLHAHEHYQDPAGEIHPDSLTNDHDDYSGDKPSDLSKTAVEWNGPNTAGSSSFVQG
HEISSNSRGSVVPDPPREDNFRPHRGRGPPKKRRPEIESDSDNEAEAGPAGKRERQGDID
ISKETLVKAEAQRPSLTLQDFQDANKWKEHSKSKKMPPYFDLIEENLYLTERKKSKSHRD
IKRMQCECPVLPREERSRGVLACGEDCLNRLLMIECSSRCLNGVYCSNRRFQMKQHADFE
VILTEDKGWGLRAAKDLTSNTFVLEYCGEVLDHKEFKTRVKEYARNKNIHYYFMSLKNNE
IIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVTAGTELTFDYQFQRYGK
EAQKCFCGAPSCRGFLGGENRVSVRAAGGKMKKDRSRKSALTTVDEELEALLENGEGLYD
EKQVVSLCRLMVRVETMEQKLICLKLIQDTQNPSCLKQFLDHHGLSLLWIFMVELSEAKG
NSANNIKLQLEIMKTLAVLPISTKNMLEESRVLTFIQRWAQTKTLPHPAEMDGYSSENTS
RAQTPLNTPDGSSTKLGPELDGDTSKPAVYRRLKIISENSLDSALSDASKASDGKEEEEE
DDDEEEDENSHAGLPDGKQLKADPVCEATDPTKDAMEESEKEVEGEKQEEAGMSSSTQPQ
PQTEEEKDKVELDLEKKDTEMKEDTSEGLKDEPEESKETGEEQESVEEQASLAVTEKAEL
ESDQSAVKVLEPESQSIQTGVSELPPEQPSEQMEAQAETQEPEKAPLDSEVQPGESTTDA
PPSSEIPEASMPSEVTVAPVDPSVIGTPSQDEEEGVSDVESERSQEPPLTTLDISGMAAR
LLDSWKDLKEVYRIPKKSQVEKEANDRSRDRDTALTPRNTSGSREREREREKERERDRDY
DRDRDRDRDRDRDRDRDRVSDKTPRSTERRRRRSVSPPSSYERSSRRTEERFDPSNSNKT
PRGVSGKERNKLSTEERRKLFEQEVAQREAQKQQQLQQQQQQQLQTMAYDPALAYASSPG
YITYPPGYPIQTFVDPTNPNAGKVLLPTPSVEPTMNYEQTPPQRLISDLGLTSPSSTSQA
TPVSNLSQHITTTNLAAGNPQQYAQPTVATQDAGVAVLSVPAQTAPQVQSQQSYTTLWDP
ATQQAVTVQTQPAQQYATAPAPAQAQTQTAIYYQGQPCQTIYSIPTAYPQANTPVIQAYT
EPTASYLHGQPVYPGHQQGVVVQQGGTVTTIVTSQTVQQEMIVPNNVIDLPPPSPPKPKT
IVLPPNWKVARDPEGKIYYYHIVTRQTQWDPPTWEGSSDNTSVDHESEMDLGTPTYDENP
SKFSTKTAEADTSSELAKKSKETFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLAR
KLTHGVMNKELKACKNPEDLECNENVKHKTKEYIKKYMQRFGSVYRPKEDTEVY
NT seq 7905 nt NT seq  +upstreamnt  +downstreamnt
atggacactctactcagagaggaggggagtggtgcctcggtaaaggttgaaggcctatcc
aaggcagctctaatgaaaagcctgtctcccagagtgatgctgtccaaccatctcttgcct
aaagggaccaagacgaaggtcaacctagaggatcagggtcgtcagaaagtgtccttcagc
ttctcacataccaagaagccactgcagagcctgttcttcatccctgccagccctgacaag
accgtcgccgaacctcaggctgccttgtcacagtcagtctcagacaaaggagggcagagt
acagacagcaaaactgaacaaaagcagacacctgtggtgccaacatcaatagcagagaca
ccttctcaaacaccagtctcctcagccactaaactgaaaccagacttggcaaagatgcat
ttcaagaagcaacttctcagtgtctctgtgactgaagagaaaccaacatcttttatgcca
gaggagcagctttcctctgaattgcagtttttgcagaagtcagcaagtaagagtgcaact
gaattcccaacaccccagtctcagaatgtcgttgatgtctgcccgtctgagaatgctcac
attgaagcctctgagatgagggtaaccccaagcctcaagaagcccgctgcttcctcagga
aaagatggagagacttccagcagtactgagcaggataaggtatacaaaaggaaaaccagg
tcccagtctaatagtgcgccccctggctcagaatctgatggagattcagtccagatgtct
tccagttgcaaatcagttgactccaaaagtaaaacaaactctgacagcaggagcaaagag
gtaaaaaagtcttcctctggttcacatgtggaggagaaggaaaaaagttgctcaaagcgg
tcagagaatcacgaaaggtcttctagttactccaaatcagaccgtgattctagacacaca
tcatcacgctcggctcgatcagacaaagatcgaagaaggtccaggtctagatcacggtct
cgatcaagagggtctcgaacaagttcatctcactccagatcagagaggtccagaggtgac
agaggatcacgctctgaaaggtcatactatcatgactctgaccggcgatcacacaggagt
tctccacgcagagagagaagacgttctcgttctcgcactgacagaactcgggacagttct
gactctgaggatgaccatagaaaaacaaggacaaggacaagtgactcgagtagatcgtct
gtccattcaagctcacataaagagtcaaaatcatcatcctcttactcaaaatcagagaaa
gtctccaaatctgtagattctcctcactcttcagagatagataaaagaacacaatcatca
aaatctgaaaggacttcaaaacgattatcagactctgattcacagcgtaagtgctctcct
gatctggactccagttaccgtaaacctagcatccatcacaagtcagagaccaacaacaaa
tcctcctcttccagtatgcatacccactctcaaacacatgaaaaatgccaaaaaagcagt
tccagtgactctgaggcagatcataaaggaaaatcatcacagggctttgacaaaagctct
ggctcagaggagaagagtaaaaactccctaaagaaaaccagtagaccagattcgaaacag
atgaccccttctagatcttctgtgaaaaccactggacatgatagacaatcagatgacatg
tttcacagttccagcaaagcaccgtcatgtgcaaccaccacagaactttgttctcagagt
gaaaaagaaaaatcagattcccatcaagatggaaatgaacttggtaatcaggatgttaag
gagatagtttcatgtactgaaaagggtttgcaagaaccatcatctacaagagcaaaagaa
actaaatcaggtcttgaagttgagaataaagatacctcagctataacctcaagtgaaagc
ctaaagcatgtaaatgcttccctggaaaacttgaccaatgtgaaggatagcctttcttct
aatcaaccgcatgtgaactcagatgcagctgtcttaaattcatgcagtagtactgaaagt
atagtgtacagccaggaaaagaaagttgttggctgttcgccagggccaaagtcctcacct
gatatagcagatgtacctgttacacataatgtccagcagaacactaaacaagagactgtt
gagctgaatatggtcgagaagcagtctgacacaagcatgccactcaaattggagtcactg
tgtcctgaacctgagaaccagcacacatgtggacaacaaagtatagataccgttaaaaag
agcggcggtactaccaaaaagtcccggtgggatattgttgggcaggacacctcagagagt
gataattcacagaggatgcttagtgcagagagtaagcctactgttaaaaaagtaatctct
gtcaaaaaaatagagttttctaaagacaatagccaacaagactctgatattaaagataat
attcaaccagaacctgaaacacattccacactggtaaagcagactgagatctctaagcag
gaggtcggctcagacagcacatccatgatcgataaatacaaagaccaaagtgagccttca
cgagcaagcaccagcattgaccactgtgacttaaaactgactgtttctcaaaaaacaaac
acagatgagcctctgcacataaatgatacatcccaggttgatgcagcggcaaagattaac
agttggaatggaaatgacctcaatgaaacatcaaaggacagcggtcacaaaaacaaattg
agtaagagaacatcacttcatcaggatgcattaggaggacagagtgagggcagtgatagt
gataactcggagtacgactccgattgtggtgaggctataaaacgattgcactctgtggtg
gtggtgccaaagaattcttccctaacaatggataccaaggacacgggagcttcctgtagt
cctatgaatatttcagaactgcacaatgccaatacagcagctgacatgaatacccatgaa
gtcccaaatgaagtcagctcccaacaaagacagagtccttccactgtatttggggagacc
agtggtccatttgctggtgtaaataactcatccaatagcagtatgttgtgtcaatcccag
agcaatatgattgacagcaccagtcactctgagggttccagtaccatcagtgccctgcct
tacatggctggtcgtatcagtgcccatggaagtgccacagatcctgctcacagccttgat
aattccagacagtgtgaacaagggcacaaacagcacactttaagtagcagaggtgaacgg
ctgtactcccattatcaacaaggtgatttctcaaatgctgacaatatcaatgacaagaat
ggattcatcctgggttgggagttttcgcaaacagagcagccaagtagtacataccagcag
cctgatagcagtcatgggccacagttaacaaacactaagttggtgggaaactctcccaag
ggacaggagcacaggcagaataatgccatctggaaccatcaatccccaaacatgcagact
agcagaaaaccttacctccatgcacatgaacattatcaggatccagcaggtgaaatccat
cctgactctctaactaatgaccatgacgactacagtggggataaaccatcagatcttagt
aaaacagctgttgaatggaatggacctaacactgcagggtcatcaagctttgtacaaggg
catgaaataagcagcaacagtaggggctctgttgtgcctgacccccctagagaagacaat
tttagaccccacagagggagaggccctcccaagaaaaggcggccggagattgagtcagat
tcagacaatgaggcagaggctgggcctgcaggcaaaagggagcgtcaaggagatattgac
atctctaaggaaactcttgtcaaagctgaggcgcaacgtccatcactcactctgcaggac
tttcaagatgccaataaatggaaagagcattccaagtctaaaaagatgcccccttacttt
gacctgattgaggagaacctctacttgactgagagaaagaaaagcaaatctcatcgagat
ataaagaggatgcagtgtgagtgcccagtgctgcccagagaggagcgctcaaggggagta
ttggcatgtggggaagactgtttaaatcggctgctgatgattgagtgctcatcacgatgc
ttaaatggagtctactgctctaatcgacgctttcagatgaaacaacatgcagactttgaa
gttatcctcacagaagacaaaggctggggtctacgggcagctaaagacttgacttcaaac
acctttgtactggaatactgcggggaggtgctggaccacaaggagttcaaaacaagagtg
aaagaatatgctcgcaataagaacatccattactacttcatgtctctaaaaaataatgag
atcattgatgcaacgttaaagggaaattgctcccggttcatgaaccacagctgtgagccc
aactgtgagacccaaaagtggaccgttaatggccagcttagagttgggttcttcaccacc
aaggccgtcactgcagggactgaactgacatttgattaccagttccagagatacggcaaa
gaagcacagaaatgcttctgtggcgcacccagctgcagaggcttcctgggtggagagaac
agagttagtgttcgagcagctggagggaagatgaagaaagaccgcagtcgaaagagtgct
ctcaccacggttgatgaggaactggaggcgctactggagaatggagaaggcctgtatgat
gagaaacaggtggtgtctctctgcagactaatggtccgagtggagaccatggagcagaaa
ctcatctgtctcaagctcatacaagatactcaaaatccatcatgcctgaagcagttcctg
gaccatcatggattgtctctgctgtggatcttcatggtggagctttctgaagccaaaggc
aacagtgcaaacaacatcaaattgcagttagagatcatgaagacgctggctgtgcttccc
atctcaactaagaacatgttggaagagagcagagtcctgaccttcattcagcgatgggcc
caaacaaaaactctccctcaccctgctgagatggatggctactccagtgagaacacctcc
cgtgctcaaacacccctcaacactcctgatggttcctccaccaaactgggacccgaatta
gatggtgacacctccaaacctgctgtgtaccgccgccttaaaatcatcagtgaaaacagt
ctagacagtgcactctctgatgctagcaaagcatctgatgggaaggaggaggaggaggaa
gatgatgatgaggaggaagatgaaaactcacacgcaggactccctgacggcaaacagttg
aaggcagacccagtgtgtgaagccacagatccaacaaaagatgcgatggaagagtcagag
aaagaggtcgaaggggagaaacaggaagaggcagggatgagttctagcactcagccccaa
cctcaaactgaggaggagaaagacaaagtggagttggatttggagaagaaggacactgag
atgaaagaggacacaagtgagggtctgaaggatgaacctgaggagtcaaaggagactggc
gaggaacaggagagtgtggaggagcaggccagtctggcagtgacagaaaaggctgaactg
gaaagtgaccagtctgctgtaaaagttcttgagccagagagtcagtccatccaaacaggt
gtttctgaacttccacctgagcagccttcagagcagatggaagcacaggcagagacacaa
gagcctgagaaggctcctcttgacagtgaagtgcaacctggtgaatctaccactgatgct
cccccaagctctgagatcccagaagccagtatgccctctgaggtcacagtggcccctgtg
gacccatcagtgataggaactccttctcaggatgaagaggaaggtgtctcagatgtggag
agtgagaggagtcaggagcccccgctcactactttggacattagcggcatggctgccagg
cttctggatagctggaaggatctaaaggaggtgtacagaataccaaagaagagtcaggtc
gaaaaggaagcaaatgatcgcagccgagatcgagacacagctttgacaccacgcaacact
tctgggagccgagaacgtgaaagggagcgagagaaggagagggaacgagacagagactat
gatcgtgaccgggatcgtgaccgagacagggaccgggaccgtgatcgagatcgagtctct
gacaaaactccccgcagcactgagagacggaggagacgctctgtgtctccaccatcatcc
tatgaaaggagcagtcgacgcactgaagaacggtttgacccatctaacagcaacaagaca
ccgagaggagtcagtggcaaggagcgcaacaaactgtccacagaggagcgcagaaagctg
ttcgagcaggaggttgctcagagggaagcccagaaacaacaacagcttcaacaacagcag
cagcagcagcttcaaactatggcttatgaccctgctctggcctatgcctccagccctggc
tatataacctacccccccggatatcctattcagacctttgtggatcccaccaaccccaat
gcaggcaaagtattgctccctaccccttcagttgaacccaccatgaactatgaacagact
cctcctcagcgacttatctcagacctgggacttacctctccatcctccacctcccaagcc
actccagtctctaatctctctcagcacatcaccaccaccaacctcgcagctggaaacccc
cagcagtatgcccagccaactgtagcaactcaggacgcaggtgtagctgtcctctctgta
ccagcccagacggcccctcaggtacagagccagcagagctacaccactctctgggaccct
gccactcagcaggcagtgactgtgcagacccagccagcacagcagtatgccacagctcca
gctccagcacaagcccagacacagacagccatctattaccagggccagccttgccaaacc
atctacagtatccccaccgcctaccctcaggctaacactccagtcatacaggcgtacact
gaacccacagccagctacttgcatggccagccggtgtatcccggccatcaacagggagtg
gtggtgcagcagggaggcacagtcaccaccattgtcacatcccaaactgtgcaacaggaa
atgattgtacccaacaatgtgatagacctgcctcctccctctccccctaaacccaaaact
atcgtcctacctcccaattggaaagtggctcgagaccctgaagggaagatctactactac
cacattgtcacaaggcaaacacagtgggaccctccaacctgggagggaagtagcgacaac
actagtgtggaccatgaatctgaaatggacctgggaacacccacgtatgatgagaatcct
tccaagttctccacgaagacagctgaagctgacacttcgagtgaactggctaaaaagagt
aaagagacatttcggaaagagatgtcccagttcatcgtgcaatgtttaaatccttatcgg
aagccagactgcaaattgggacgcatcagcaacaccgaagacttcaaacacctggctaga
aagctgactcatggagttatgaataaggagctgaaagcttgtaagaatcctgaggacctc
gagtgtaacgagaatgtgaagcacaagaccaaggagtacatcaagaagtacatgcagaga
tttggctctgtatacaggcccaaggaggacacagaggtgtactag

DBGET integrated database retrieval system