KEGG   Seriola dumerili (greater amberjack): 111236982
Entry
111236982         CDS       T05606                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04210  Apoptosis
sdu04620  Toll-like receptor signaling pathway
sdu04621  NOD-like receptor signaling pathway
sdu04622  RIG-I-like receptor signaling pathway
sdu04623  Cytosolic DNA-sensing pathway
sdu04625  C-type lectin receptor signaling pathway
sdu04920  Adipocytokine signaling pathway
sdu05132  Salmonella infection
sdu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111236982 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111236982 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111236982 (ikbkg)
   04621 NOD-like receptor signaling pathway
    111236982 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    111236982 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    111236982 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    111236982 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111236982 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111236982 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111236982 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdu01001]
    111236982 (ikbkg)
Protein kinases [BR:sdu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   111236982 (ikbkg)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 HBS1_N
Other DBs
NCBI-GeneID: 111236982
NCBI-ProteinID: XP_022621629
LinkDB
Position
Unknown
AA seq 638 aa
MTAWVPVIPDNTTEKGLGMVQPQPDGPMQWDMSGEESGGALRVPPELAANEVVTRLLGDN
QQLREALRRSNLALRQRCEEMEGWQRRTREEREFLSSRFQEARALVERLAQENHSLQSLV
SGPTSSSNHCCSSSQTEDLQGRPARNGPLEGPQTLDQREKKRVEETDQHTQTTPPRSLGG
ASVHSSLSSPLPTPPASFSEVLGEVMGRESGQPVEGANEFLQLLKSHKEKLEEGMRELRR
KNEELERDRDEGEKERERMRRCIDQLRAKLAQAQVSNVTEENVPHRSEAQHSSDCSSLAK
LTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSL
LGELNERQSCLEKSEHERKMLEEKLCSKLKALQVAERELEQQRKQHHVAMDKLLLQTQSL
EQALKTERHVVTEEKKKLTQLQHAYTCLFRDYDSKLKSEGGDLCSRLEEAERALALKQDL
IDKLKEEVEQQKGSLETVPVLAAQAEIYKADFLAEREAREKLNQKKEELQDQLNQAQAEI
ERLKQDAASRARMEQMKMRHMEDFPPRAPLIPPPQGVFPGPAFNTVPPAPSFRNQGLVPV
GDQGAAGAEELPDLCCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgacagcctgggtgcctgttattccggacaacacaactgaaaaaggactggggatggtg
cagccccaacctgatggcccaatgcagtgggacatgtcaggagaggagagtggaggggcc
ctcagggtcccaccagagcttgctgccaatgaagtggtgaccaggctgctgggtgataac
cagcagcttagagaggccttgcggcggagcaacctggccttgcgtcagcgctgtgaggag
atggagggatggcagcgaaggacaagagaggaaagagaatttctcagctctcgtttccag
gaggccagggccctggtggagaggctggcccaggagaaccactccttacagagcctggtc
agtggtccgacctcctcttctaaccactgctgcagctccagccaaaccgaagacctgcaa
ggacgcccagccaggaacggtccactcgaaggaccacagactctagatcagcgggagaag
aagagagttgaagagacggatcaacacacacagaccacgccacctcgcagcctgggcggt
gcgagtgtgcatagctccttgagtagccccctccccactccccccgcctcattttcagag
gtactgggggaggtgatgggcagggaaagtggccagcctgtggaaggtgcaaacgagttc
ctgcagctgctgaagagccataaagaaaaactggaggaagggatgagagagctgaggagg
aagaacgaagagctggagagagacagagacgagggagagaaagagagagaacggatgcgg
cgttgcattgaccaactacgagccaaactggcgcaggcacaggtgagcaacgttactgag
gagaatgttccacatcgctctgaggcgcagcactcctctgactgctctagcctggctaaa
ctcacagagcagcttcaggccacacagggcaggtatcgggagctggaggagaagcttgat
tacctgcagaagagttcggctcagcgagacagaactgaagctctgctcaaacagaaggac
aaagactgtgctcagctggccaaagactgtgaggctctgaaagctcaggcaacttccctg
ttaggagaactgaatgagagacagagctgcctggagaaaagcgagcatgaacgcaaaatg
ttggaagaaaaactgtgcagtaagctgaaggcactgcaggtggcagagcgggagctggag
cagcagaggaagcagcatcatgtggccatggacaagctgctgctgcagacccagagcctg
gagcaggccctgaagacagagagacatgtcgtcacggaggagaaaaaaaaactgacacag
ctgcaacacgcctacacatgtctctttagagactacgactctaaactgaagagtgaggga
ggagatctgtgcagccgactagaggaggcagagcgagcgctggctctgaagcaggatctg
atcgataaactgaaggaggaggtggagcaacagaaaggctccctggagactgttcctgtc
ctcgctgcacaggctgagatctacaaggcagatttcctggcagagcgagaagcaagagag
aagttgaaccagaagaaggaggagctgcaagatcaactgaatcaggcccaggctgagatt
gaaaggctcaaacaggatgctgcatcacgcgcacgtatggagcaaatgaagatgaggcac
atggaggactttccaccacgggccccgctcattcctcctccacaaggtgtgttccccggg
ccagcttttaacacagtgccccctgccccctcattccgcaatcagggtttggtaccagtc
ggtgatcaaggagcagctggagctgaggagctgccagatttatgttgtccaaagtgccag
taccaggctccagatatggacacactgcagatacatgtcatggactgtatacagtaa

DBGET integrated database retrieval system