KEGG   Seriola dumerili (greater amberjack): 111237500
Entry
111237500         CDS       T05606                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
sdu04540  Gap junction
sdu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111237500
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111237500
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111237500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sdu04030]
    111237500
G protein-coupled receptors [BR:sdu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    111237500
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 111237500
NCBI-ProteinID: XP_022622344
LinkDB
Position
Unknown
AA seq 354 aa
MDEEQCYYNETIAFFYNRSGKHLASDWNTVSRLVMGLGITVCIFIMLANLLVMIAIYVNR
RFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVAN
LLAIAIERHITVFRMQLHTRMSNRRVVVVIVIIWTMSIVMGAIPSVGWNCICSISTCSNM
APLYSNSYLVFWAVFNLVTFVVMVTLYAHIFVYVRQRTMRMSRHSSGPRRNRDTMMSLLK
TVVIVLGAFIVCWTPGLVILLLDVFCASCNVLTYEKFFLLLAEFNSAMNPIIYSYRDKEM
SATFRQILCCQRQENVNGTAAEGSDRSASSINHTVLSGSGMHHHHHHHNEHSVV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggatgaggaacagtgctactacaatgagaccatcgccttcttctacaaccgcagcggc
aagcaccttgcttctgactggaacaccgtcagcaggctggtgatgggcctgggcatcact
gtgtgcatcttcatcatgctcgccaacctcctggtgatgatcgccatctacgtcaacagg
agattccacttccccatctactacctgatggccaacctggcagctgctgacttctttgct
ggactggcctacttctacttgatgttcaacacgggaccaaacacgaggcgtctgactgtt
tccacgtggctgctccgccaaggcctaattgacaccagcctgacggcgtctgtggccaac
ttgcttgccatcgccatcgagcgccacatcaccgtgttccgcatgcagctacacacacgt
atgagcaaccgacgtgtggttgtggtgattgtcataatctggaccatgtccatagtaatg
ggggccatccccagtgtgggctggaactgtatctgtagtattagtacttgttccaacatg
gcaccgctttacagcaactcctacctggtcttctgggcagtgtttaacctggtgacgttt
gttgtcatggtgacgctgtatgcccacatctttgtgtatgtgcggcagaggaccatgagg
atgtcacggcacagctctggaccacggcgtaaccgagataccatgatgtctctgctgaaa
accgtggtgattgtgttgggggcgttcattgtctgctggacgcccggcttggtcatcctc
ctccttgacgtcttctgcgcaagctgcaacgtcctcacctacgaaaagttcttcctactt
ctcgccgagttcaactcggccatgaaccccatcatctactcctaccgtgacaaggagatg
agcgccaccttcaggcagattctgtgctgccagcgccaggagaacgtcaacggaacggcc
gcggagggatctgaccggtcggcgtcatccatcaaccatacggtgctcagcggcagcggt
atgcaccaccatcaccaccaccacaacgaacactcagtagtataa

DBGET integrated database retrieval system