KEGG   Seriola dumerili (greater amberjack): 111238917Help
Entry
111238917         CDS       T05606                                 

Definition
(RefSeq) caskin-2-like
  KO
K21952  CASK-interacting protein
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sdu04131]
    111238917
Membrane trafficking [BR:sdu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    111238917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caskin-Pro-rich Ank_2 SAM_1 Ank_4 Ank_5 Ank SAM_2 Caskin-tail Ank_3 Caskin1-CID SH3_2 SH3_1 SH3_9
Motif
Other DBs
NCBI-GeneID: 111238917
NCBI-ProteinID: XP_022624361
LinkDB All DBs
Position
Unknown
AA seq 1365 aa AA seqDB search
MGKEQDLLQAVKSGDLLSTQKLLSKLKTNRNKLLGSTKRLNVNYQDSDGFSALHHAALTG
TTELLTALLEAQATVDIKDSNGMRPLHYAAWQGKAESVLMLLRSGASVNGVSLDGHIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRVKVAQLLLSSNMVVALLEGE
RKEPTDSAFTTPLHLAARNGHKDIIRLLLKAGIDINKTTKSGTALHEASLYGKTEVVRLL
LDAGVDVNIRNTYNQTALDIVNQFTTSHASKDIKQLLRDATGVLQVRALKDYWNLHDPTA
LNIRAGDIITVLEQHVDGRWKGHIHDSPRGMDRVGFFPPSIVEVISRRNGGTLSRHASLP
TGQRQQLLSRAPLSSSLSSAPQTDDSYTLYAPPTHVVLPLANGLTASTGLSPSRLSQSGC
PFEDIWVLRDSCHAGDRNSVGSTGSVGSTRSAGSGQSTESNNAPNGLQHHAGHHDNANKV
APPAADAGHSDLSKQPDHPAGGTPRRQAVTVQRPAEQSFSQQFVRPQQLLEGKDAEAIYQ
WLGDFQLEQYTGNFISAGYDVPTISRMTPEDLTAIGVTKPGHRKKISIEINNLNIPEWLP
EYIPSDLVEWLSAIGLPQYHKKLSENGYDSISIVKDLTWEDLQEIGITKLGHQKKLMLAV
KKLCDIQRAILQAESDQGTLRRKGPGALHLVTIEPPDPAGESSSPHTPKMLTFQDSELSA
ELQTAMSSHYGGCEDGLAIKNAVGMSQSQESIDTRSRGSGRSQEPPTASVTPHSWSQESL
DGSPAKERNLPEGWDQRPLQQQPPPKQVPLGTATVFKYPAIPTKPKLSGSGGPSPHGSPA
LKGFSYLHSHCGSTDLSSSPRSADHTLTLTPPKKRTQSMTRYALSDGEPDEDDDEPASGN
LSSYATLTRKPGRSQLARLQSSPEKNGNVGRSQSFAVRARKKGPPPPPPKRLSSVSSTAS
GELSDSSTTSPGGRVLTNSPGSVRSITASLEGNADGRSSLGPKPDLIHQEPPPPSLTSAE
QEPREAAGVRRRVQSECIPTHTSSEPDRGVKSDSEEEESKGRGLEGSSSPHNSSSECIPF
AEEGNLTIKQRPKAPGPPRAEAVLEPPEKAAAKNLEVPEFNLKESDTVKRRHKPKDKEAG
GGSPSREGAGASGSESGGSRPPSQSQEEVSLRISEAGLERPSSPATGSPIKPPLSPKPPT
VAPKPVRHSLLAAQAAGPSSPAVTVSVVQSVAFTSPSSPSHGPSAPAPPPPPAPAPAPAP
APAPAPAPAPALTSAPQSPSLAAARPQVCVVGPGLVPEASCGTEVVQQRLDQTSTSLEAA
LKAVERKLEDDSDGGVSTVKSAGTILDDIGNMFDDLADQLDAMLD
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggagcaggacctgctgcaggcggtgaagagcggagacctgctgtccactcag
aagctgctgtccaagctcaagaccaacaggaacaagctgctgggctccaccaagagactg
aacgtcaactaccaggactcagatgggttctcggccctgcaccacgctgctctcacaggg
accacagagctcctgactgcgctgctggaggctcaggccactgtggacatcaaggacagc
aatgggatgcgtcctctgcactacgcggcctggcaggggaaggcggagtctgtcctgatg
ctgctgcgctccggcgcctcggtcaacggcgtctctctggacggacatattccgctgcac
ctggccgctcagtatggacactatgaagtgtctgagatgctgctgcagcatcagtccaac
ccctgtctggtcaacaaggccaagaagacgcctctggacctggcctgtgagttcggacga
gtcaaggtggcccagctgttgctgagcagtaacatggtggtggcgttgttggagggagag
aggaaggagccgacagactccgccttcaccaccccgctgcacctcgccgcccggaatggc
cataaagacatcatacggctgctgctgaaggccggcatcgacatcaacaagaccaccaag
tctggaacggctctgcacgaggcgtctctgtacgggaagacggaggtggtgcggctgctg
ctggacgccggcgtggacgtgaacatcaggaacacctacaaccagacggcgctggacatc
gtcaaccagttcaccacgtcacacgccagcaaggacatcaagcagctgctgcgagatgcg
acgggagtcttgcaggtcagagctctgaaggactactggaacctccacgatcccaccgcc
ctcaacatccgggccggtgacatcatcacggtgttggagcagcatgtggacggacgctgg
aagggacacatccacgacagcccgagagggatggaccgagtcggcttcttccctccgtcc
atcgtggaggtgatcagcaggaggaacgggggcaccctctcccggcacgcctctctgccc
accggacagcgccagcagctgctgtccagagcccccctctcctccagcctcagctccgcc
ccccagactgacgactcctacactctgtacgccccccccacccacgtggtgctgccgctg
gccaacggcctcactgccagcacaggtctgtctccgagccgcctgtcccagtccgggtgt
cccttcgaggacatctgggttctcagggactcgtgtcatgctggagacaggaacagcgtc
ggcagcacaggtagcgtcggcagcacgcgcagcgccgggagcggacagagcacggagagc
aacaacgcacccaacggactgcaacaccacgccggtcaccatgacaacgccaacaaggtg
gcgccccctgctgctgatgctggacactcagacctcagtaaacagcctgaccatcctgca
ggtgggactcctcggaggcaggcggtgacggtgcagagacctgcagagcagagcttctcc
cagcagtttgtccgtcctcagcagctgttggaggggaaggatgcagaggccatctatcag
tggctgggtgacttccagctggagcagtacaccgggaacttcatcagcgctggttacgat
gtaccgaccatcagcaggatgactcctgaggacctgactgccatcggagtgaccaaacca
ggccaccgcaagaagatttccattgagatcaacaacctgaacatccctgagtggctgcct
gagtacatcccatctgacctggtcgagtggctcagcgccatcggcctcccgcagtaccac
aagaaactgtcggagaacggctacgactccatcagcatcgtcaaagacctgacgtgggag
gatctgcaggagatcggcatcaccaagctcggccaccagaagaagctgatgttggcggtg
aagaagctgtgcgacatccagagagcgatcctccaggccgaatcggaccaaggcacgctg
cgacgcaaaggccccggagccctgcacctggtcaccatcgagccgcccgaccccgccggt
gagagctcttctcctcacaccccgaagatgctgaccttccaggacagcgagctgagcgcc
gagctgcagacggccatgtccagccactacggaggctgcgaggacggtctggccatcaag
aacgccgtgggcatgtcccagagccaggagagcatcgacacccggtcccgaggctccggc
cgctcccaggagcctccgacagcctccgtcacgccacacagctggtcccaggagagtctg
gacggcagccccgccaaggagaggaacctccccgagggctgggaccagaggcctctgcag
cagcagccgccgcccaagcaggttcctctgggcacggccacggtgttcaagtacccggcc
atcccgaccaagcccaaactgtctgggtccggtggcccctccccccacggctccccggcg
ctgaagggtttcagctacctgcattctcactgtggctccacagacctgagctcctccccc
aggtctgcggaccacaccctgaccctgacgccgcccaagaagcgcacccagagcatgacc
cgctacgccctgtcggacggagaacccgacgaggacgacgacgaacccgcgtccgggaac
ctgtcgtcctacgccaccttaacccgcaagccgggccgcagccagctggcccgactccag
tccagtccagagaagaacggcaacgtggggcgcagtcagtcatttgctgtgcgcgcccgg
aaaaagggtccccctcctcccccgccaaagagactgagttcagtgagcagcaccgccagc
ggggagctgagcgacagcagcaccacgtcgcctggcggccgggtgctcaccaacagtccc
ggcagcgtcaggagcatcaccgcctctctggagggaaacgcagacgggaggagctcccta
ggaccaaaaccagacctcatccaccaggagccgcctcccccctccctcacctctgcagag
caggaacccagggaggcagcgggggtgaggaggagggtgcagagcgagtgtattcccacc
cacaccagctccgagccggaccggggggtgaagtctgactcagaggaggaggaatctaaa
ggtcggggactggagggatcctcgtccccccacaacagctccagtgagtgcatccccttc
gcagaggagggaaacctgaccatcaaacagaggcccaaagctccggggccccccagggcc
gaggccgtgctggagcctccagagaaagcagcagccaagaacctggaggttcccgagttc
aacctgaaggagtcggacacggtgaagcgccgacacaaacccaaagacaaggaggcggga
ggaggctcccccagcagagagggagcgggggcgtccggctcagagtccggcggcagcaga
cctccgtcccagagccaggaggaggtcagtctgaggatcagtgaggccggtctggagcgg
ccctccagtccagctacagggtcccccatcaaacccccgctctccccgaaacctcccact
gtcgcccccaaaccagtccgccacagtctgctggctgcacaagcagctggaccctcctct
ccagctgtgaccgtcagcgtggttcaaagcgtggccttcacgtctccatcctccccgtcc
cacgggccctcagctccggctccgcctccacctccggctccggctccggctccggctccg
gctccggctccggctccggctccggctccggctctgacctcggcccctcagagtccctct
ctggcagcagcgaggcctcaggtgtgtgtggtgggtccaggtctcgtccctgaggcttcc
tgtgggactgaggtggttcagcagagactggatcagaccagcacgtctctggaagcagct
ctgaaggcggtggagaggaaactggaggacgactcagatggcggcgtgagcacggtgaag
tctgccgggaccatcctggacgacatcggcaacatgttcgacgacctggccgaccagctg
gacgccatgttggactga

DBGET integrated database retrieval system