KEGG   Streptomyces davaonensis: BN159_1996Help
Entry
BN159_1996        CDS       T02518                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00250  Alanine, aspartate and glutamate metabolism
sdv00410  beta-Alanine metabolism
sdv00640  Propanoate metabolism
sdv00650  Butanoate metabolism
sdv01100  Metabolic pathways
sdv01120  Microbial metabolism in diverse environments
Module
sdv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN159_1996
   00650 Butanoate metabolism
    BN159_1996
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN159_1996
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN159_1996
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdv01007]
    BN159_1996
Enzymes [BR:sdv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BN159_1996
Amino acid related enzymes [BR:sdv01007]
 Aminotransferase (transaminase)
  Class III
   BN159_1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CCK26375
UniProt: K4QZX0
LinkDB All DBs
Position
complement(2203834..2205123)
Genome map
AA seq 429 aa AA seqDB search
MTGDDLLGRHRRVLPDWLALYYEDPLEITHGEGRHVWDSEGNKYLDFFGGILTTMTAHAL
PEVTKAVSEQAGRILHSSTLYLNRPMVELAERIAQLSGIPDARVFFTTSGTEANDTALLL
ATTYRQSNTILAMRNSYHGRSFSAVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYAELD
DRDFVAACVEDLKDLLGHTRPPAALIAEPIQGVGGFTSGPDGLYAAFRDVLAERGILWIA
DEVQTGWGRTGEHFWGWQAHGQSGPPDIVTFAKGIGNGASIGGVIARAEIMNCLDANSIS
TFGGTQITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVGAQVPYVREVRGRGLMIG
IELAEPGTGRAAPEAASAVLEAARAGGLLIGKGGGHDTSALRIAPPLTLSVAEAEEGAAI
LERALRGLQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggagacgatctgctgggacgccaccgccgggtgctgcccgactggctcgcgctc
tactacgaggacccgctggagatcacccatggcgagggccgccatgtctgggactccgag
ggcaacaagtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgcgctg
cccgaggtgaccaaggcggtgagcgagcaggccgggcggatcctgcactcctcgacgctc
tatctcaaccggccgatggtggaactcgccgagcggatcgcccagttgagtggcatcccg
gacgcccgggtcttcttcaccacctccggcaccgaggccaacgacacggccctgctgctc
gcgacgacgtaccggcagagcaacacgatcctggcgatgcgcaacagctaccacggccgc
tccttcagcgccgtcggcatcaccggcaaccgcggctggtccccgacctccctgtcaccg
ctccagacgctctacgtccacggcggcgtccgcacccgcggcccgtacgccgagctggac
gaccgtgacttcgtcgcggcctgcgtcgaggacctgaaggacctgctcgggcacacccgc
ccgcccgccgccctcatcgccgagcccatccagggcgtcggcgggttcacctcgggcccg
gacgggctgtacgccgccttccgtgacgtgctcgcggagcggggcatcctgtggatcgcc
gacgaggtgcagaccggctggggccgcaccggcgagcacttctggggctggcaggcgcac
gggcagagcggaccgcccgacatcgtcaccttcgccaagggcatcggcaacggcgcgtcc
atcggcggggtgatcgcccgggccgagatcatgaactgcctggacgccaacagcatctcg
acgttcggcggcacccagatcaccatggcggccgggctcgcgaacctgacgtacctcctg
gagcacgacctccagggcaacgcccggcgggtcggcgggctgctcatcgagcggctgcgg
gcggtcggcgcccaggtgccgtacgtacgggaggtgcgcgggcgcgggctgatgatcggc
atcgagctggccgaacccggcaccggccgggcggcgcccgaggcggcgtcggccgtgctg
gaggcggcccgcgcgggcgggctgctgatcggcaagggcggcggccatgacaccagcgcg
ctgcggatcgccccgccgctgacgctgtccgtcgcggaggcggaggagggcgccgcgatc
ctggaacgcgctctcagaggtcttcagtaa

DBGET integrated database retrieval system